Clone Name | bart20f01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-assoc... | 32 | 1.8 | 2 | WNT6_HUMAN (Q9Y6F9) Protein Wnt-6 precursor | 31 | 2.4 | 3 | CQ028_HUMAN (Q8IV36) Protein C17orf28 (Down-regulated in multipl... | 31 | 3.1 | 4 | PRP2_RAT (P10164) Acidic proline-rich protein PRP25 precursor (F... | 29 | 9.0 |
---|
>BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2157 Score = 31.6 bits (70), Expect = 1.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 407 PPSSASLPGTPERGAPSQSPWRYSKDHASETEAGWWPGA 523 PP AS PG PE GAP R+ + W PG+ Sbjct: 832 PPYLASYPGFPENGAPGPPISRFPLEEPGPRPLPWPPGS 870
>WNT6_HUMAN (Q9Y6F9) Protein Wnt-6 precursor| Length = 365 Score = 31.2 bits (69), Expect = 2.4 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 386 ESPRNLRPPSSASLPGTPERGAPSQSPWRYSKDHASETEAGW-WPGAPHD 532 ++PR PP + LPGTP P+ SP E A W W G D Sbjct: 135 QAPRGRAPPRPSGLPGTPGPPGPAGSP---------EGSAAWEWGGCGDD 175
>CQ028_HUMAN (Q8IV36) Protein C17orf28 (Down-regulated in multiple cancers-1)| Length = 788 Score = 30.8 bits (68), Expect = 3.1 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 395 RNLRPPSSASLP-GTPERGAPSQSPWRYSKDHASETEAGWWPGAP 526 R+L P SL G+P +G PSQ+ WR + ++ + +G W P Sbjct: 639 RSLEPEPQQSLEDGSPAKGEPSQA-WREQRRPSTSSASGQWSPTP 682
>PRP2_RAT (P10164) Acidic proline-rich protein PRP25 precursor (Fragment)| Length = 172 Score = 29.3 bits (64), Expect = 9.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 404 RPPSSASLPGTPERGAPSQSPWRYSK 481 RPP++ S G P +G P QSP + K Sbjct: 42 RPPANGSQQGPPPQGGPQQSPLQPGK 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,782,031 Number of Sequences: 219361 Number of extensions: 804902 Number of successful extensions: 3210 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3177 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)