Clone Name | bart20c11 |
---|---|
Clone Library Name | barley_pub |
>MS84C_DROME (Q01644) Male-specific sperm protein Mst84Dc| Length = 55 Score = 31.2 bits (69), Expect = 2.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 370 PCCDCCVHYCCEPC 411 PC CC +YCC PC Sbjct: 5 PCGSCCGYYCCGPC 18
>DISI_AGKPI (P16338) Disintegrin applagin (Platelet aggregation activation| inhibitor) Length = 71 Score = 30.4 bits (67), Expect = 4.3 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 11/43 (25%) Frame = +1 Query: 361 PDAPCCD-----------CCVHYCCEPCALVQEYKELKARGYD 456 P+ PCCD C CC+ C ++E +ARG D Sbjct: 11 PENPCCDAATCKLRPGAQCAEGLCCDQCKFMKEGTVCRARGDD 53
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 30.4 bits (67), Expect = 4.3 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = +1 Query: 370 PCCD--CCVHYCCEPC 411 PCC CCV CC+PC Sbjct: 36 PCCQPSCCVSSCCQPC 51
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 30.4 bits (67), Expect = 4.3 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = +1 Query: 370 PCCD--CCVHYCCEPC 411 PCC CCV CC+PC Sbjct: 36 PCCQPSCCVSSCCQPC 51
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 30.4 bits (67), Expect = 4.3 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = +1 Query: 370 PCCD--CCVHYCCEPC 411 PCC CCV CC+PC Sbjct: 31 PCCQPSCCVSSCCQPC 46
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 30.4 bits (67), Expect = 4.3 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = +1 Query: 370 PCCD--CCVHYCCEPC 411 PCC CCV CC+PC Sbjct: 31 PCCQPSCCVSSCCQPC 46
>PLAC8_HUMAN (Q9NZF1) Placenta-specific gene 8 protein (C15 protein)| Length = 115 Score = 30.4 bits (67), Expect = 4.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 319 SCTYRSKMRAQYALPDAPCCDCCVHYCCEPCALVQEYKELKAR 447 S R+ R +Y +P + C D CC C L Q +++ R Sbjct: 67 SVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRR 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,319,563 Number of Sequences: 219361 Number of extensions: 705947 Number of successful extensions: 2573 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2553 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)