Clone Name | bart19e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CPXR_BRAJA (Q59204) Cytochrome P450 BJ-3 (EC 1.14.14.-) (Cytochr... | 30 | 1.9 | 2 | UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (E... | 27 | 9.2 |
---|
>CPXR_BRAJA (Q59204) Cytochrome P450 BJ-3 (EC 1.14.14.-) (Cytochrome P450 114)| Length = 429 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 205 ATGTVARASMRRCRSPTVAAAASGTVMRSVPSRLRMRRII 86 A G +AR R SP++ AS M+ P+ R+RR+I Sbjct: 70 APGELARYFSRAATSPSLNLLASTLAMKDPPTHTRLRRLI 109
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 10 QSKAAAAIPSPRREKEKEKRHPQP 81 Q + A IP P R + KE+R+P P Sbjct: 20 QPRVGAKIPFPPRARSKERRNPVP 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.299 0.118 0.334 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,764,422 Number of Sequences: 219361 Number of extensions: 195598 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.6 bits)