| Clone Name | bart19b10 |
|---|---|
| Clone Library Name | barley_pub |
>LEU3_THIFE (Q56268) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 358 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 324 DEGGRLALAPAVLPVREVGVGRRQL-PVHGSRPDLS 220 DE +L + +LP +G GR P+HGS PD++ Sbjct: 250 DEASQLTGSIGMLPSASLGEGRAMYEPIHGSAPDIA 285
>UPP_NOCFA (Q5Z187) Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP| pyrophosphorylase) (UPRTase) Length = 207 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 381 LRLAKVAAVEVDVPRPPGVDEGGRLALAPAVLPVREVGVG 262 LR A V E++ P P G RLA P ++PV G+G Sbjct: 44 LREAPVDTYEINTPVAPAT--GARLAQPPLLVPVLRAGLG 81
>ANGE1_HUMAN (Q9UNK9) Angel homolog 1| Length = 670 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 217 EREIWAGAMDGKLPPPNPNLPYREDCWSEGE 309 E IW G+L PP +PY E W E E Sbjct: 194 EASIWPFEGLGQLQPPAVEIPYHEILWREWE 224
>CAP_SCHPO (P36621) Adenylyl cyclase-associated protein (CAP)| Length = 551 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 244 DGKLPPPNPNLPYREDCWSEGETAALVD---AWGSRYIDLNRG 363 +G LPPP P P D W + A D G+ + ++N+G Sbjct: 302 NGGLPPPPPPPPPSNDFWKDSNEPAPADNKGDMGAVFAEINKG 344
>STAB1_MOUSE (Q8R4Y4) Stabilin-1 precursor (FEEL-1 protein)| Length = 2571 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 327 VDEGGRLALAPAVLPVREVGVGRRQLPVH 241 + EGGR+ L P +PVR V V +H Sbjct: 608 ISEGGRILLGPGGIPVRRVDVPAANGVIH 636
>DPOL_PYRHO (O59610) DNA polymerase (EC 2.7.7.7) [Contains: Pho pol intein (Pho| Pol I intein)] Length = 1235 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 280 YREDCWSEGETAALVDAWGSRYIDLNRGNL 369 Y + W E A V AWG +YIDL R L Sbjct: 960 YAKARWYCKECAESVTAWGRQYIDLVRREL 989
>DPOL_PYRAB (P77916) DNA polymerase 1 (EC 2.7.7.7) (Pab polymerase)| Length = 771 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 280 YREDCWSEGETAALVDAWGSRYIDLNRGNL 369 Y + W E A V AWG +YIDL R L Sbjct: 500 YAKARWYCKECAESVTAWGRQYIDLVRREL 529 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,073,207 Number of Sequences: 219361 Number of extensions: 615814 Number of successful extensions: 2348 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2348 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)