| Clone Name | bart18f10 |
|---|---|
| Clone Library Name | barley_pub |
>Y207_AERPE (Q9YFP2) UPF0148 protein APE0207| Length = 129 Score = 26.2 bits (56), Expect(2) = 5.0 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 187 EDQRSAGAEWCGVERSGRAALGDLREQRLADGRRRGDGEQEK 62 ED ++W GV + L R R G RG+G + K Sbjct: 88 EDNVDTVSKWLGVLETAERILAIRRGSRQGQGSVRGEGRESK 129 Score = 22.7 bits (47), Expect(2) = 5.0 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -1 Query: 234 VVCPLHG--VVMAGAERSR 184 VVCP+HG V++A E +R Sbjct: 45 VVCPVHGKVVIVASDEEAR 63
>EMBA_MYCTU (P0A560) Probable arabinosyltransferase A (EC 2.4.2.-)| Length = 1094 Score = 30.0 bits (66), Expect = 5.3 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +2 Query: 152 TAPLSAGRPLVLDLSAPA---ITTPCSGQTTTVTLSANSTD 265 TAPL +G P LD+S P T P +G TL A D Sbjct: 59 TAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVD 99
>EMBA_MYCBO (P0A561) Probable arabinosyltransferase A (EC 2.4.2.-)| Length = 1094 Score = 30.0 bits (66), Expect = 5.3 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +2 Query: 152 TAPLSAGRPLVLDLSAPA---ITTPCSGQTTTVTLSANSTD 265 TAPL +G P LD+S P T P +G TL A D Sbjct: 59 TAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVD 99
>COAT_GMDNV (Q90125) Coat protein VP1 (Structural protein VP1) [Contains: Coat| protein VP (Structural protein VP2); Coat protein VP3 (Structural protein VP3); Coat protein VP4 (Structural protein VP4)] Length = 811 Score = 29.6 bits (65), Expect = 6.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 197 APAITTPCSGQTTTVTLSANSTDGSNPLS 283 +PA+ TP TT V +++ STD NP S Sbjct: 334 SPAVETPAKKGTTGVNVNSQSTDPQNPSS 362
>NFAC1_PIG (O77638) Nuclear factor of activated T-cells, cytoplasmic 1 (NFAT| transcription complex cytosolic component) (NF-ATc1) (NF-ATc) (NFATmac) Length = 822 Score = 29.6 bits (65), Expect = 6.9 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 19 ETQAENGAVQASSGASPARRLHG 87 ET+ GAV+AS+G P+ +LHG Sbjct: 433 ETEGSRGAVKASAGGHPSVQLHG 455
>FMP1_PSEAE (P17838) Fimbrial protein precursor (Pilin) (Strain P1)| Length = 157 Score = 29.3 bits (64), Expect = 9.1 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 110 LTKITKSGASTALYTAPLSAGRPLVLDLSAPAITTPCSGQTTTVTLSANSTDGS 271 + K+T G TA S G +V + A + TP G+T T+TL N+ GS Sbjct: 85 VAKVTTGG------TAAASGGCTIVATMKASDVATPLRGKTLTLTL-GNADKGS 131
>ACS2_CANAL (Q8NJN3) Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA| ligase 2) (Acyl-activating enzyme 2) (Fragment) Length = 581 Score = 29.3 bits (64), Expect = 9.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 466 HAVAGEPGPAVAREAQRERVGHLLCFGHLSRERS 365 HA A PA+ EA E+ H+L +G L RE S Sbjct: 101 HAFANPDKPALICEADDEKDSHILTYGDLLREVS 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.131 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,728,967 Number of Sequences: 219361 Number of extensions: 842494 Number of successful extensions: 2310 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2304 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)