Clone Name | bart17e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UCRI_MAIZE (P49727) Ubiquinol-cytochrome c reductase iron-sulfur... | 40 | 0.001 | 2 | GPTC2_HUMAN (Q9NW75) G patch domain-containing protein 2 | 28 | 4.9 | 3 | GPTC2_MOUSE (Q7TQC7) G patch domain-containing protein 2 | 28 | 8.3 |
---|
>UCRI_MAIZE (P49727) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 273 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 111 MLRVAGRRLSSSLSWRPAGTV 173 MLRVAGRRLSSSLSWRPA V Sbjct: 1 MLRVAGRRLSSSLSWRPAAAV 21
>GPTC2_HUMAN (Q9NW75) G patch domain-containing protein 2| Length = 528 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +3 Query: 48 PSRD*TTIPNLSEEDEDDADEMLRVAGRRLSSSLS 152 PS+D N +++D D+D+ + VA RR SS+L+ Sbjct: 99 PSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLN 133
>GPTC2_MOUSE (Q7TQC7) G patch domain-containing protein 2| Length = 527 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +3 Query: 48 PSRD*TTIPNLSEEDEDDADEMLRVAGRRLSSSLS 152 PS+D + +++D D+D+ + VA RR SS+LS Sbjct: 98 PSKDYREKHSNNKKDRSDSDDQMLVAKRRPSSNLS 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.126 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,854,764 Number of Sequences: 219361 Number of extensions: 199704 Number of successful extensions: 636 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)