Clone Name | bart17b12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YG0H_SCHPO (O94729) Hypothetical protein C1604.17c in chromosome II | 30 | 5.4 | 2 | T2C_PARTE (Q27181) Trichocyst matrix protein T2-C precursor (Sec... | 29 | 9.3 |
---|
>YG0H_SCHPO (O94729) Hypothetical protein C1604.17c in chromosome II| Length = 459 Score = 30.0 bits (66), Expect = 5.4 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 405 TKEGKPAGYNTKWDELHADSQKALLQIEDKIREY 506 T +G+P + D+ H+D KALL+ + K + Y Sbjct: 171 TDQGRPVAFELPPDKFHSDQSKALLEPKWKTKNY 204
>T2C_PARTE (Q27181) Trichocyst matrix protein T2-C precursor (Secretory| granule protein T2-C) (TMP 2-C) [Contains: Trichocyst matrix protein T2-C 1; Trichocyst matrix protein T2-C 2] Length = 387 Score = 29.3 bits (64), Expect = 9.3 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +3 Query: 408 KEGKPAGYNTKWDELHADSQKALLQIEDKIREYKDESERLDQCSRLHDSSISNVNF 575 K+ + GY DEL A + E+K+ E+++ + + + RL +I + +F Sbjct: 126 KQAEVKGYQKDLDELDAQRAEEKADFEEKVLEHQEATAIIAEARRLFADNIEHESF 181 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,258,964 Number of Sequences: 219361 Number of extensions: 500901 Number of successful extensions: 1945 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1945 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)