Clone Name | bart15h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | K0329_HUMAN (O15040) Protein KIAA0329/KIAA0297 | 29 | 8.9 | 2 | TOLB_CHLMU (Q9PJE1) Protein tolB precursor | 29 | 8.9 |
---|
>K0329_HUMAN (O15040) Protein KIAA0329/KIAA0297| Length = 1411 Score = 28.9 bits (63), Expect = 8.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 494 HGASVLEGCKAQTRASDRSGSGSCACPCRSGP 399 HG +L G + SD +G G CP GP Sbjct: 577 HGRELLNGAREDVGGSDVTGLGDEPCPADDGP 608
>TOLB_CHLMU (Q9PJE1) Protein tolB precursor| Length = 426 Score = 28.9 bits (63), Expect = 8.9 Identities = 18/70 (25%), Positives = 29/70 (41%), Gaps = 4/70 (5%) Frame = +2 Query: 251 RDLHRGGIPVGYLLLPRREEPE----DNSAYVSVFIALASEGTDVRALFELTLQDQSGKG 418 RDL + +G LL P +E ++Y + ++ +G + +F L L K Sbjct: 56 RDLFARDLALGDLLAPTKEIAPLTVFIEASYPELIFSIKKDGKGAQKIFSLELSGNPSKD 115 Query: 419 KHKIHSHFDR 448 IH DR Sbjct: 116 HQSIHEAADR 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,469,324 Number of Sequences: 219361 Number of extensions: 1107189 Number of successful extensions: 3591 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3591 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)