ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bart15c12 |
|---|---|
| Clone Library Name | barley_pub |
>RNS3_ARATH (P42815) Ribonuclease 3 precursor (EC 3.1.27.1)| Length = 222 Score = 108 bits (270), Expect(2) = 1e-25 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCNPRQRLRS 316 D+DFFY VLQWPG+YCD++ SCCYP+TGKPAADF IHGLWPN G +PQNCNP R Sbjct: 21 DFDFFYFVLQWPGAYCDSRHSCCYPQTGKPAADFGIHGLWPNYKTGGWPQNCNPDSRFDD 80 Query: 317 LQ 322 L+ Sbjct: 81 LR 82 Score = 25.8 bits (55), Expect(2) = 1e-25 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 309 FDPSKVSDLLSSLRAEW 359 FD +VSDL+S L+ EW Sbjct: 78 FDDLRVSDLMSDLQREW 94
>RNLE_LYCES (P80022) Extracellular ribonuclease LE precursor (EC 3.1.27.1)| (RNase LE) Length = 230 Score = 110 bits (275), Expect = 8e-25 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCNP 298 D+DFFY V QWPGSYCDTK+SCCYP TGKPAADF IHGLWPN +DG+YP NC+P Sbjct: 28 DFDFFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNNNDGTYPSNCDP 81
>RNS1_ARATH (P42813) Ribonuclease 1 precursor (EC 3.1.27.1)| Length = 230 Score = 103 bits (257), Expect = 1e-22 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCN 295 D+DFFY V QWPGSYCDT+K CCYP +GKPAADF IHGLWPN DG+YP NC+ Sbjct: 29 DFDFFYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCD 81
>RNLX_LYCES (P80196) Intracellular ribonuclease LX precursor (EC 3.1.27.1)| (RNase LX) Length = 237 Score = 99.4 bits (246), Expect = 2e-21 Identities = 39/58 (67%), Positives = 44/58 (75%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCNPRQRL 310 D+DFFY V QWP SYCDT++SCCYP TGKP DF IHGLWPN DG +PQNC+ L Sbjct: 27 DFDFFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYKDGKWPQNCDRESSL 84
>RNS2_ARATH (P42814) Ribonuclease 2 precursor (EC 3.1.27.1)| Length = 259 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYP----RTGKPAADFRIHGLWPNRDDGSYPQNC 292 ++D+F L LQWPG+YC + CC R F IHGLWP+ +DGS+P C Sbjct: 31 EFDYFALSLQWPGTYCRGTRHCCSKNACCRGSDAPTQFTIHGLWPDYNDGSWPSCC 86
>RNS2_ANTHI (Q38716) Ribonuclease S-2 precursor (EC 3.1.27.1) (Stylar| glycoprotein 2) (S2-RNase) Length = 235 Score = 55.1 bits (131), Expect = 4e-08 Identities = 29/52 (55%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYP-QNC 292 +D+F LVLQWP SYC K + C PRT P + F IHGLWP D+ S+P NC Sbjct: 33 FDYFKLVLQWPNSYCSLKTTHC-PRTRLP-SQFTIHGLWP--DNKSWPLSNC 80
>RNDI_DICDI (Q7M438) Ribonuclease DdI precursor (EC 3.1.27.1) (RNase DdI)| Length = 223 Score = 53.5 bits (127), Expect = 1e-07 Identities = 25/53 (47%), Positives = 31/53 (58%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCN 295 D+DF+ V QW SYCD++ C + A F IHGLWP DGSYP C+ Sbjct: 31 DFDFYLFVQQWIYSYCDSQT--CIQNKEREA--FTIHGLWPENSDGSYPSFCS 79
>RNOY_CRAGI (Q7M456) Ribonuclease Oy (EC 3.1.27.-) (RNase Oy)| Length = 213 Score = 45.4 bits (106), Expect = 3e-05 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRD-DGSYPQNCN 295 D+++F QWP + C KSC P + + IHGLWP+ D + P+NCN Sbjct: 2 DWNYFTFAQQWPIAVCAEHKSCFIPDS---VVGWGIHGLWPSSDTESKGPENCN 52
>RNS7_PYRPY (O80325) Ribonuclease S-7 precursor (EC 3.1.27.1) (S7-RNase)| Length = 226 Score = 45.1 bits (105), Expect = 4e-05 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 5/68 (7%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC-----NPRQ 304 YD+F Q+ + C++K + C P F +HGLWP+ +G +P+NC NP Sbjct: 28 YDYFQFTQQYQPAVCNSKPTPC---KDPPDKLFTVHGLWPSNLNGPHPENCTNATVNP-H 83 Query: 305 RLRSLQGE 328 R++++Q + Sbjct: 84 RIKNIQAQ 91
>RNS4_ANTHI (Q38717) Ribonuclease S-4 precursor (EC 3.1.27.1) (Stylar| glycoprotein 4) (S4-RNase) Length = 233 Score = 44.3 bits (103), Expect = 7e-05 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +2 Query: 143 DFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC--NPRQRLRS 316 D+ LVLQWP S+C C R P+ +F IHGLWP+ PQ+C N QR Sbjct: 34 DYLKLVLQWPKSFCLINSRKCQ-RNPLPS-NFTIHGLWPDNYTRQAPQSCTTNNFQRFTD 91 Query: 317 LQGERPAEQ 343 E+ E+ Sbjct: 92 TDIEQRMEE 100
>RNS3_PETHY (Q40875) Ribonuclease S-3 precursor (EC 3.1.27.1) (Stylar| glycoprotein 3) (S3-RNase) Length = 222 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNR 265 ++D+F LVL WP S+C K C + + +F IHGLWP + Sbjct: 23 NFDYFQLVLTWPASFCYPKNKC-----QRRSNNFTIHGLWPEK 60
>RNS2_SOLTU (Q01796) Ribonuclease S-2 precursor (EC 3.1.27.1) (Stylar| glycoprotein 2) (S2-RNase) Length = 223 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNR 265 D+D+ LVL WP S+C + C P +F IHGLWP++ Sbjct: 23 DFDYMQLVLTWPRSFCYPRGFC----NRIPPNNFTIHGLWPDK 61
>RNMC_MOMCH (P23540) Ribonuclease MC (EC 3.1.27.1) (RNase MC)| Length = 191 Score = 40.8 bits (94), Expect = 8e-04 Identities = 21/51 (41%), Positives = 28/51 (54%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC 292 +D F+ V QWP + C +KS P +G F IHGLWP + G+ NC Sbjct: 1 FDSFWFVQQWPPAVCSFQKSGSCPGSG--LRTFTIHGLWP-QGSGTSLTNC 48
>RNPB_PHYPO (P81477) Ribonuclease Phyb (EC 3.1.27.-) (RNase Phyb)| Length = 180 Score = 40.0 bits (92), Expect = 0.001 Identities = 19/52 (36%), Positives = 22/52 (42%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCN 295 +DFF V +W S F IHGLWP DGSYP C+ Sbjct: 5 FDFFIFVTEWNASISTEY--------------FTIHGLWPENSDGSYPSGCS 42
>RNS2_PYRPY (Q40965) Ribonuclease S-2 precursor (EC 3.1.27.1) (S2-RNase)| Length = 221 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/65 (30%), Positives = 32/65 (49%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCNPRQRLRSL 319 YD+F Q+ ++C++ + C P F +HGLWP+ G P+ C + R R + Sbjct: 23 YDYFQFTQQYQQAFCNSNPTPC---KDPPDKLFTVHGLWPSTKVGRDPEYCKTK-RYRKI 78 Query: 320 QGERP 334 Q P Sbjct: 79 QRLEP 83
>RNS1_PYRPY (O80322) Ribonuclease S-1 precursor (EC 3.1.27.1) (S1-RNase)| Length = 228 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC 292 YD+F Q+ + C++ + C T K F +HGLWP+ +G P+ C Sbjct: 28 YDYFQFTQQYQPAVCNSNPTPCNDPTDKL---FTVHGLWPSNRNGPDPEKC 75
>RNTR_TRIVI (P24657) Ribonuclease Trv (EC 3.1.27.1) (RNase Trv)| Length = 234 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 209 PRTGKPAADFRIHGLWPNRDDGSYPQNCN 295 P TG P+ + IHGLWP+ DGS+PQ C+ Sbjct: 41 PSTG-PSDSWTIHGLWPDNCDGSFPQTCD 68
>RNS5_PYRPY (P93460) Ribonuclease S-5 precursor (EC 3.1.27.1) (S5-RNase)| Length = 227 Score = 39.3 bits (90), Expect = 0.002 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC---NPRQRL 310 YD+F Q+ + C++ ++ C P F +HGLWP+ G P NC N R+R Sbjct: 28 YDYFQFTQQYQLAVCNSNRTPC---KDPPDKLFTVHGLWPSSMAGPDPSNCPIRNIRKRE 84 Query: 311 RSLQ 322 + L+ Sbjct: 85 KLLE 88
>RNL2_LENED (P81296) Ribonuclease Le2 (EC 3.1.27.1) (RNase Le2)| Length = 239 Score = 38.1 bits (87), Expect = 0.005 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 209 PRTGKPAADFRIHGLWPNRDDGSYPQNCNP 298 P TG P + IHGLWP+ DGS+ ++C+P Sbjct: 40 PETG-PTDSWTIHGLWPDNCDGSFSEDCDP 68
>RNS4_PYRPY (Q40966) Ribonuclease S-4 precursor (EC 3.1.27.1) (S4-RNase)| Length = 228 Score = 38.1 bits (87), Expect = 0.005 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC 292 +D+F Q+ + C++ + C T K F +HGLWP+ +G P+ C Sbjct: 28 FDYFQFTQQYQPAVCNSNPTPCNDPTDKL---FTVHGLWPSNRNGPDPEKC 75
>RNS3_PYRPY (O80323) Ribonuclease S-3 precursor (EC 3.1.27.1) (S3-RNase)| Length = 222 Score = 37.7 bits (86), Expect = 0.007 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC---NPRQRL 310 YD+F Q+ + C++ ++ C P F +HGLWP+ G P C N R+R Sbjct: 23 YDYFQFTQQYQLAVCNSNRTLC---KDPPDKLFTVHGLWPSNMVGPDPSKCPIKNIRKRE 79 Query: 311 RSLQ 322 + L+ Sbjct: 80 KLLE 83
>RNS7_NICAL (Q40381) Ribonuclease S-7 precursor (EC 3.1.27.1) (Stylar| glycoprotein 7) (S7-RNase) Length = 218 Score = 37.4 bits (85), Expect = 0.009 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQN-CNPRQRLRS 316 +++ LVLQWP ++C T P +F IHGLWP D+ S N C ++ ++ Sbjct: 24 FEYMQLVLQWPTAFCHTTPCKRIPN------NFTIHGLWP--DNVSTTLNYCAAKENFKN 75 Query: 317 LQGE 328 ++ + Sbjct: 76 IEDD 79
>RNS6_NICAL (Q40379) Ribonuclease S-6 precursor (EC 3.1.27.1) (Stylar| glycoprotein 6) (S6-RNase) Length = 215 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPN 262 +++ LVLQWP ++C T P ++F IHGLWP+ Sbjct: 24 FEYMQLVLQWPTAFCHTTPCKNIP------SNFTIHGLWPD 58
>RN28_PANGI (P83618) Ribonuclease-like storage protein precursor (Root 28 kDa| major protein) Length = 238 Score = 33.9 bits (76), Expect(2) = 0.014 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 Query: 149 FYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCN 295 F L LQWP +C+ +C T F IHGL+P G+ C+ Sbjct: 32 FALRLQWPAGFCEVNNAC---DTKSLLNTFTIHGLYPYNAKGTPALYCD 77 Score = 21.9 bits (45), Expect(2) = 0.014 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 306 AFDPSKVSDLLSSLRAEW 359 AFD + VSD L+ + W Sbjct: 80 AFDVNSVSDFLAEMHLAW 97
>RNI_AERHY (Q07465) Ribonuclease precursor (EC 3.1.27.-)| Length = 215 Score = 35.8 bits (81), Expect = 0.026 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTK---KSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCNPRQR 307 ++D++ + L W +C K + C + G F +HGLWP G YP +C R+R Sbjct: 28 EFDYYAMALSWSPEHCAIKPADRDQCSRQLG-----FVLHGLWPQYQRG-YPSSCT-RER 80 Query: 308 L 310 L Sbjct: 81 L 81
>RNS11_NICAL (Q7SID5) Ribonuclease S-F11 (EC 3.1.27.1) (Stylar glycoprotein F11)| (SF11-RNase) Length = 196 Score = 35.8 bits (81), Expect = 0.026 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDTKKSCCYPRTGKPAA--DFRIHGLWPNRDDGSYPQNCNPR 301 D+++ LVL WP S+ CY + A +F IHGLWP+ + + NC P+ Sbjct: 1 DFEYLQLVLTWPASF-------CYANHCERIAPNNFTIHGLWPD-NVKTRLHNCKPK 49
>RNY1A_CANAL (Q5AK94) Ribonuclease T2-like 1-A precursor (EC 3.1.27.1) (RNase| T2-like A) Length = 399 Score = 35.8 bits (81), Expect = 0.026 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 15/52 (28%) Frame = +2 Query: 185 DTKKSCCYPRTGK---------------PAADFRIHGLWPNRDDGSYPQNCN 295 DT SCCY G PA F IH +W + G YPQ C+ Sbjct: 37 DTSNSCCYENPGGIILFTQFWDYNPASGPADSFTIHSIWNDYCSGGYPQFCD 88
>RNM_ASPSA (P19791) Ribonuclease M (EC 3.1.27.1) (RNase M)| Length = 238 Score = 35.8 bits (81), Expect = 0.026 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 15/52 (28%) Frame = +2 Query: 185 DTKKSCCYPRTGK---------------PAADFRIHGLWPNRDDGSYPQNCN 295 D + SCC+ G P+ + IHGLWP+ DGSY + C+ Sbjct: 16 DNEASCCFNSPGGSLLQTQFWDYDPSDGPSDSWTIHGLWPDNCDGSYQEYCD 67
>RNY1_DEBHA (Q6BHB1) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 403 Score = 35.4 bits (80), Expect = 0.035 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 206 YPRTGKPAADFRIHGLWPNRDDGSYPQNCNPRQRLRS 316 YP G + F +HGLWP+ DG+Y Q C+ +RS Sbjct: 72 YPPIGGNES-FTLHGLWPDNCDGTYEQFCDDSLNIRS 107
>RNS6_PYRPY (O80324) Ribonuclease S-6 precursor (EC 3.1.27.1) (S6-RNase)| Length = 229 Score = 35.4 bits (80), Expect = 0.035 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDGSYPQNC 292 Y++F Q+ + C++ + C P F +HGLWP+ D G P C Sbjct: 28 YNYFQFTQQYQPAVCNSNPTPC---KDPPDKLFTVHGLWPSNDVGDDPIYC 75
>RNY1_YARLI (Q6CAV7) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 406 Score = 35.4 bits (80), Expect = 0.035 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 236 FRIHGLWPNRDDGSYPQNCNPRQRLRSL 319 F +HGLWP+ DGSY Q C+ ++S+ Sbjct: 89 FTLHGLWPDNCDGSYAQFCDKSMEVQSV 116
>RNT2_ASPOR (P10281) Ribonuclease T2 precursor (EC 3.1.27.1) (RNase T2)| Length = 276 Score = 34.3 bits (77), Expect = 0.077 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNCN 295 P+ + IHGLWP+ DGSY Q C+ Sbjct: 63 PSDSWTIHGLWPDNCDGSYGQFCD 86
>RNY1_YEAST (Q02933) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 434 Score = 34.3 bits (77), Expect = 0.077 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNCNPRQRLRSLQ 322 P F IHGLWP+ G Y Q CN RSLQ Sbjct: 80 PLDSFTIHGLWPDNCHGGYQQFCN-----RSLQ 107
>RNY1_ASHGO (Q75BW5) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 292 Score = 34.3 bits (77), Expect = 0.077 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNCNPRQRLRSL 319 P F IHGLW +R DGS+ Q C +RS+ Sbjct: 89 PDDSFTIHGLWNDRCDGSWDQFCRRGSSIRSV 120
>RNY1_KLULA (Q6CRT6) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 425 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNCN 295 P F HGLWP+ DG+Y Q CN Sbjct: 85 PLDSFTNHGLWPDNCDGTYAQFCN 108
>RNY1_ASPFU (Q4WXZ5) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 414 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNCNPRQRLRSL 319 P + IHGLWP+ DG + Q C+ ++R ++ Sbjct: 78 PVDSWTIHGLWPDFCDGGFDQYCDSKRRYSNI 109
>RNY1_CANGA (Q6FP42) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 433 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNC 292 P F IHGLWP+ G YPQ C Sbjct: 81 PVDSFTIHGLWPDDCMGGYPQFC 103
>RNS2_NICAL (P04007) Ribonuclease S-2 precursor (EC 3.1.27.1) (Stylar| glycoprotein 2) (S2-RNase) Length = 214 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 140 YDFFYLVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPN 262 +++ LVL WP ++C K + +F IHGLWP+ Sbjct: 24 FEYMQLVLTWPITFCRIK------HCERTPTNFTIHGLWPD 58
>RNT2_HUMAN (O00584) Ribonuclease T2 precursor (EC 3.1.27.-) (Ribonuclease 6)| Length = 256 Score = 32.0 bits (71), Expect = 0.38 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +2 Query: 155 LVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRDDG---SYPQN 289 +V WP + C+ ++ C P + IHGLWP++ +G S+P N Sbjct: 39 MVQHWPETVCEKIQNDCRD----PPDYWTIHGLWPDKSEGCNRSWPFN 82
>RNY1B_CANAL (Q5AKB1) Ribonuclease T2-like 1-B precursor (EC 3.1.27.1) (RNase| T2-like B) Length = 413 Score = 30.4 bits (67), Expect = 1.1 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 16/50 (32%) Frame = +2 Query: 197 SCCY----------------PRTGKPAADFRIHGLWPNRDDGSYPQNCNP 298 SCCY P TG P F HGLW N YPQ C+P Sbjct: 53 SCCYESPAGVILLTQFWDYNPATG-PDNLFTQHGLWGNMCSYGYPQFCDP 101
>RNI_ECOLI (P21338) Ribonuclease I precursor (EC 3.1.27.6) (Enterobacter| ribonuclease) (RNase I) Length = 268 Score = 30.0 bits (66), Expect = 1.5 Identities = 19/75 (25%), Positives = 29/75 (38%), Gaps = 9/75 (12%) Frame = +2 Query: 137 DYDFFYLVLQWPGSYCDT--------KKSCCYPRTGKPAADF-RIHGLWPNRDDGSYPQN 289 D+D + L L W +C + + C ADF +HGLWP + Sbjct: 33 DFDRYVLALSWQTGFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARG 92 Query: 290 CNPRQRLRSLQGERP 334 + R+ +R RP Sbjct: 93 VDERRWMRFGCATRP 107
>RNY1_EMENI (Q5B3K6) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 417 Score = 30.0 bits (66), Expect = 1.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 224 PAADFRIHGLWPNRDDGSYPQNCNPRQRLRSL 319 P + IHGLWP+ +G + Q C+ ++ ++ Sbjct: 85 PENSWTIHGLWPDHCNGGFDQFCDSHRKYSNI 116
>ALG2_RHIPU (O94738) Alpha-1,3-mannosyltransferase ALG2 (EC 2.4.1.-)| (GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase) Length = 455 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 258 GQSPWILKSAAGFPVRG*QQLFFVSQYDPGHC 163 G ++ +A G +G Q +F+ S +DP HC Sbjct: 19 GAERLVVDAAVGIQKKGHQVIFYTSHHDPNHC 50
>RN26_HAEIN (P44012) Probable ribonuclease HI0526 precursor| Length = 272 Score = 29.6 bits (65), Expect = 1.9 Identities = 21/77 (27%), Positives = 30/77 (38%), Gaps = 12/77 (15%) Frame = +2 Query: 143 DFFYLVLQWPGSYCDTKK---------SCCYPRTGKPAADFRIHGLWPNRDDGSYPQNCN 295 D++ L L W +CD ++ S Y + +HGLW PQN N Sbjct: 105 DYYMLALSWSPGFCDIQREKYGDQLPYSSQYQCGNNRTFGWVVHGLW--------PQNAN 156 Query: 296 PR---QRLRSLQGERPA 337 R R +G+ PA Sbjct: 157 ARAVSDHPRFCKGDLPA 173
>RNT2_MOUSE (Q9CQ01) Ribonuclease T2 precursor (EC 3.1.27.-) (Ribonuclease 6)| Length = 259 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 155 LVLQWPGSYCDTKKSCCYPRTGKPAADF-RIHGLWPNRDDGSYPQNCN 295 L WP + C SC + + D+ IHGLWP+R ++CN Sbjct: 44 LTQHWPPTVCKEVNSC------QDSLDYWTIHGLWPDR-----AEDCN 80
>RNRH_RHINI (P08056) Ribonuclease Rh precursor (EC 3.1.27.1) (RNase Rh)| Length = 238 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 12/40 (30%) Frame = +2 Query: 197 SCCYPRTGK------------PAADFRIHGLWPNRDDGSY 280 +CC P G P F +HGLWP++ G+Y Sbjct: 34 TCCSPEYGLVVLNMQWAPGYGPDNAFTLHGLWPDKCSGAY 73
>SYE_BRAJA (Q89KR5) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 475 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 248 GLWPNRDDGSYPQNCNPRQRLRSLQ-GERPAEQPARG 355 G+W +RD + P + P RLR+ Q GE E +G Sbjct: 125 GMWRDRDPATAPSDVKPTIRLRAPQTGETVIEDQVQG 161
>RNT2_PIG (Q7M329) Ribonuclease T2 (EC 3.1.27.-)| Length = 200 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +2 Query: 155 LVLQWPGSYCDTKKSCCYPRTGKPAADFRIHGLWPNRD---DGSYPQN 289 +V WP + C+ +K+C +P + IHGLWP++ + S+P N Sbjct: 8 MVHHWPMTVCN-EKNCEHPPDY-----WTIHGLWPDKSGECNRSWPFN 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,282,386 Number of Sequences: 219361 Number of extensions: 380688 Number of successful extensions: 705 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)
