Clone Name | bart14d08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BRCA1_CANFA (Q95153) Breast cancer type 1 susceptibility protein... | 30 | 4.2 | 2 | FBXL7_HUMAN (Q9UJT9) F-box/LRR-repeat protein 7 (F-box and leuci... | 30 | 4.2 | 3 | MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1 | 30 | 7.1 | 4 | YKJ7_YEAST (P34245) Hypothetical 15.4 kDa protein in APE1/LAP4-C... | 29 | 9.3 |
---|
>BRCA1_CANFA (Q95153) Breast cancer type 1 susceptibility protein homolog| Length = 1878 Score = 30.4 bits (67), Expect = 4.2 Identities = 21/72 (29%), Positives = 27/72 (37%) Frame = -2 Query: 259 PQGHEQTRVAAQDTEPAVNTDGGEHKTTTHKGQGTANHTGAHECASLGLTNCVSKVARGG 80 P H +T QD EPA G K ++ G+ +H L LTN A Sbjct: 657 PVRHNKTLQLMQDKEPA-----GRAKKSSKPGEQINKRLASHAFPELTLTNVSGFFANYS 711 Query: 79 HEESLQICCSPG 44 Q C +PG Sbjct: 712 SSSKPQECINPG 723
>FBXL7_HUMAN (Q9UJT9) F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat| protein 7) (F-box protein FBL6/FBL7) Length = 491 Score = 30.4 bits (67), Expect = 4.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 400 CPRQCRNWRSRSRSPRLWDHLYLGQHLRAENVRIDRS 510 C R CR W + + PRLW + L E + +DR+ Sbjct: 137 CARVCRRWYNLAWDPRLWRTI----RLTGETINVDRA 169
>MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1| Length = 2042 Score = 29.6 bits (65), Expect = 7.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 387 PVSEKPVSKPYRANSGRAVLLLPREAMPWATKNSTSCRTIEPI 259 PV+ KP S+ R + ++ + P A+P A + S T +PI Sbjct: 1520 PVTPKPTSRATRGRARKSSVKTPEPAVPTAAEPQPSASTDQPI 1562
>YKJ7_YEAST (P34245) Hypothetical 15.4 kDa protein in APE1/LAP4-CWP1 intergenic| region Length = 136 Score = 29.3 bits (64), Expect = 9.3 Identities = 17/62 (27%), Positives = 24/62 (38%) Frame = +3 Query: 159 PCPLWVVVLCSPPSVFTAGSVSWAATLVCSCPCGSAQSFYS*CCSLLPKASPRAGAIALP 338 P P V+ + +P ++ W C C S +S CC LPK P A Sbjct: 18 PVPAVVLGVMAPKRAYSTPFGPWPGPAECLWNCPSELRQFSSCCLPLPKLRPPRPTFASL 77 Query: 339 YR 344 +R Sbjct: 78 WR 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,831,601 Number of Sequences: 219361 Number of extensions: 1767256 Number of successful extensions: 5014 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5010 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)