Clone Name | bart14c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FBXL7_HUMAN (Q9UJT9) F-box/LRR-repeat protein 7 (F-box and leuci... | 30 | 4.6 | 2 | BRCA1_CANFA (Q95153) Breast cancer type 1 susceptibility protein... | 30 | 4.6 | 3 | MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1 | 30 | 7.9 |
---|
>FBXL7_HUMAN (Q9UJT9) F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat| protein 7) (F-box protein FBL6/FBL7) Length = 491 Score = 30.4 bits (67), Expect = 4.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 404 CPRQCRNWRSRSRSPRLWDHLYLGQHLRAENVRIDRS 514 C R CR W + + PRLW + L E + +DR+ Sbjct: 137 CARVCRRWYNLAWDPRLWRTI----RLTGETINVDRA 169
>BRCA1_CANFA (Q95153) Breast cancer type 1 susceptibility protein homolog| Length = 1878 Score = 30.4 bits (67), Expect = 4.6 Identities = 21/72 (29%), Positives = 27/72 (37%) Frame = -1 Query: 263 PQGHEQTRVAAQDTEPAVNTDGGEHKTTTHKGQGTANHTGAHECASLGLTNCVSKVARGG 84 P H +T QD EPA G K ++ G+ +H L LTN A Sbjct: 657 PVRHNKTLQLMQDKEPA-----GRAKKSSKPGEQINKRLASHAFPELTLTNVSGFFANYS 711 Query: 83 HEESLQICCSPG 48 Q C +PG Sbjct: 712 SSSKPQECINPG 723
>MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1| Length = 2042 Score = 29.6 bits (65), Expect = 7.9 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 391 PVSEKPVSKPYRANSGRAVLLLPREAMPWATKNSTSCRTIEPI 263 PV+ KP S+ R + ++ + P A+P A + S T +PI Sbjct: 1520 PVTPKPTSRATRGRARKSSVKTPEPAVPTAAEPQPSASTDQPI 1562 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,475,019 Number of Sequences: 219361 Number of extensions: 1841296 Number of successful extensions: 5386 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5382 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)