Clone Name | bart12g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39... | 29 | 6.9 | 2 | THB1_SHEEP (Q28571) Thyroid hormone receptor beta-1 (Fragment) | 29 | 9.0 |
---|
>YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39 intergenic| region Length = 352 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/53 (22%), Positives = 32/53 (60%) Frame = +2 Query: 296 YCQNHLTGLVLFSWCKLMDPMTLLIASYLMLVVFTKPRLIVQKMLLQGLQIRM 454 Y ++ + +LFS+ + ++ LI S ++ ++F +PR + K ++G ++++ Sbjct: 214 YEESVILSFMLFSFIIWVILISKLILSIIIFIIFIRPRFLSSKRKVKGYELKL 266
>THB1_SHEEP (Q28571) Thyroid hormone receptor beta-1 (Fragment)| Length = 411 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 355 HDSVDSFISDAGSVYKTKIDSAKNAATGLTDKDELIVIRSDESSG 489 HD V + + ++T+ K DKDEL V+ D+++G Sbjct: 70 HDDVSDQSAPSAQAFQTEEKKCKGYIPSYLDKDELCVVCGDKATG 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,535,065 Number of Sequences: 219361 Number of extensions: 975960 Number of successful extensions: 2225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2224 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)