| Clone Name | bart09g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DYC1_CAEEL (Q8STF6) Dystrophin-like protein 1 (Dyb-1-binding and... | 29 | 3.7 | 2 | LAD1_HUMAN (O00515) Ladinin 1 (Lad-1) (120 kDa linear IgA bullou... | 29 | 3.7 | 3 | SMCA4_HUMAN (P51532) Probable global transcription activator SNF... | 29 | 4.9 |
|---|
>DYC1_CAEEL (Q8STF6) Dystrophin-like protein 1 (Dyb-1-binding and CAPON-related| protein) Length = 887 Score = 29.3 bits (64), Expect = 3.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 208 PAGSEQMPARNS-PIADHVSIGRRGERPPPRADLRV 104 P SE P RN+ P + + S+ RRG PPP D+ + Sbjct: 808 PEPSEMDPNRNNLPSSTNSSMKRRGFLPPPNTDVEI 843
>LAD1_HUMAN (O00515) Ladinin 1 (Lad-1) (120 kDa linear IgA bullous dermatosis| antigen) (97 kDa linear IgA bullous dermatosis antigen) (Linear IgA disease antigen homolog) (LadA) Length = 517 Score = 29.3 bits (64), Expect = 3.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 220 SGGSPAGSEQMPARNSPIADHVSIGRRGERPPPRADLRVP 101 SGGSPA +++ R P + S+ ++G PP R+P Sbjct: 298 SGGSPATTKEQRGRALPGKNLPSLAKQGASDPPTVASRLP 337
>SMCA4_HUMAN (P51532) Probable global transcription activator SNF2L4 (EC| 3.6.1.-) (ATP-dependent helicase SMARCA4) (SNF2-beta) (BRG-1 protein) (Mitotic growth and transcription activator) (Brahma protein homolog 1) (SWI/SNF-related matrix-associated actin Length = 1647 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 193 QMPARNSPIADHVSIGRRGERPPPRADLRVPS 98 +M AR P+ DH+ + +G+RP P ++P+ Sbjct: 188 KMLARGQPLPDHLQMAVQGKRPMPGMQQQMPT 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.132 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,564,984 Number of Sequences: 219361 Number of extensions: 603018 Number of successful extensions: 1200 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)