Clone Name | bart09g05 |
---|---|
Clone Library Name | barley_pub |
>GP116_HUMAN (Q8IZF2) Probable G-protein coupled receptor 116 precursor| Length = 1346 Score = 30.4 bits (67), Expect = 3.4 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 427 HCLILSLATLFLWSHVCIFIHKSPPNIPEVKIPEDLTVNI 546 H LI +FL H C + + PPN P + ED+T+N+ Sbjct: 135 HNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNM 174
>RTN2_MOUSE (O70622) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 471 Score = 30.0 bits (66), Expect = 4.5 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 4/80 (5%) Frame = +1 Query: 313 ADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLA---TLFLWSHVCIF 483 ADL+ W++ + SG V G A L ++ + ++++ H +L L +L ++ V Sbjct: 273 ADLLYWKDTRTSGAVFTGLMASLLC--LLHFSIVSVAAHLALLGLCATISLRVYRKVLQA 330 Query: 484 IHKSPPNIP-EVKIPEDLTV 540 +H+ P + + DLT+ Sbjct: 331 VHRGDGTNPFQAYLDMDLTL 350
>PK1L1_MOUSE (Q8R526) Polycystic kidney disease 1-like 1 protein| (Polycystin-1L1) (Fragment) Length = 531 Score = 29.6 bits (65), Expect = 5.9 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 399 HDLEQQPDGRSASEHPSGDLLVPP*NKISRLAAAEDGV 286 HD +PD R S HP+ DLL P ++ R+AA+ V Sbjct: 320 HDSSGRPDSRHPSPHPTSDLL-PWTDQAWRIAASSSAV 356
>RTN2_HUMAN (O75298) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 545 Score = 29.3 bits (64), Expect = 7.7 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 4/84 (4%) Frame = +1 Query: 301 GGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLA---TLFLWSH 471 G K ADL+ W++ + SG V G L ++ + ++++ H +L L +L ++ Sbjct: 342 GSKVADLLYWKDTRTSGVVFTGLMVSLLC--LLHFSIVSVAAHLALLLLCGTISLRVYRK 399 Query: 472 VCIFIHKSPPNIP-EVKIPEDLTV 540 V +H+ P + + DLT+ Sbjct: 400 VLQAVHRGDGANPFQAYLDVDLTL 423
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 28.9 bits (63), Expect = 10.0 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 308 LPPPRTAWTGCSRP 267 LPPP+TAWT SRP Sbjct: 383 LPPPKTAWTENSRP 396 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,151,695 Number of Sequences: 219361 Number of extensions: 737293 Number of successful extensions: 2699 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2697 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)