| Clone Name | bart09c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CADA_BACPF (P30336) Probable cadmium-transporting ATPase (EC 3.6... | 28 | 9.9 | 2 | POLG_HCVVA (Q9QAX1) Genome polyprotein [Contains: Core protein p... | 28 | 9.9 | 3 | SYTC_ARATH (Q8GZ45) Probable threonyl-tRNA synthetase, cytoplasm... | 28 | 9.9 |
|---|
>CADA_BACPF (P30336) Probable cadmium-transporting ATPase (EC 3.6.3.3) (Cadmium| efflux ATPase) Length = 723 Score = 28.5 bits (62), Expect = 9.9 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 320 VMLAPGAEALDSSNLETASARLTGDDLHASPSRLASDRRAASV 192 V +A G D++ LETA L GDDL PS + R+ ++ Sbjct: 630 VGIAMGGAGTDTA-LETADVALMGDDLRKLPSTVKLSRKTLNI 671
>POLG_HCVVA (Q9QAX1) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 28.5 bits (62), Expect = 9.9 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = -3 Query: 308 PGAEALDSSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 165 PG +LD L + P+R DRR A + RPL S K Sbjct: 1118 PGTRSLDPCTCGAVDLYLVTRNADVIPARRQGDRRGALLSPRPLSSLK 1165
>SYTC_ARATH (Q8GZ45) Probable threonyl-tRNA synthetase, cytoplasmic (EC| 6.1.1.3) (Threonine--tRNA ligase) (ThrRS) Length = 458 Score = 28.5 bits (62), Expect = 9.9 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 187 PLTLAALRSEASLEGDAWRSSPVSLADAVSKLLESSASAPGAN 315 P+ + L EG W +SP+ +A +SK L SA N Sbjct: 42 PIKITLLPDGIEKEGRRWETSPMDIAVQISKGLAKSALVSSVN 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.122 0.322 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,031,773 Number of Sequences: 219361 Number of extensions: 283823 Number of successful extensions: 1085 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)