Clone Name | bart07e01 |
---|---|
Clone Library Name | barley_pub |
>PSA3_ORYSA (Q9LSU0) Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S| proteasome alpha subunit G) (20S proteasome subunit alpha-7) Length = 249 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS G GYDLSVTTFSPDGRVFQVEYA Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQVEYA 27
>PSA3_SPIOL (O24362) Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S| proteasome alpha subunit G) (20S proteasome subunit alpha-7) (Proteasome component C8) Length = 249 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS G GYDLSVTTFSPDGRVFQ+EYA Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYA 27
>PSA3_ARATH (O23715) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome| subunit alpha type 7) (20S proteasome alpha subunit G-1) (Proteasome component 8) (DiDi 17A-2a) Length = 249 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS G GYDLSVTTFSPDGRVFQ+EYA Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYA 27
>PSA3_RAT (P18422) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome| component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) Length = 254 Score = 48.1 bits (113), Expect = 6e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 176 SSKGXGYDLSVTTFSPDGRVFQVEYA 253 SS G GYDLS +TFSPDGRVFQVEYA Sbjct: 1 SSIGTGYDLSASTFSPDGRVFQVEYA 26
>PSA3_MOUSE (O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome| component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) Length = 254 Score = 48.1 bits (113), Expect = 6e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 176 SSKGXGYDLSVTTFSPDGRVFQVEYA 253 SS G GYDLS +TFSPDGRVFQVEYA Sbjct: 1 SSIGTGYDLSASTFSPDGRVFQVEYA 26
>PSA3_HUMAN (P25788) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome| component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) Length = 254 Score = 48.1 bits (113), Expect = 6e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 176 SSKGXGYDLSVTTFSPDGRVFQVEYA 253 SS G GYDLS +TFSPDGRVFQVEYA Sbjct: 1 SSIGTGYDLSASTFSPDGRVFQVEYA 26
>PSA3_ACACA (P90513) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Fragment)| Length = 252 Score = 47.4 bits (111), Expect = 1e-05 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 179 SKGXGYDLSVTTFSPDGRVFQVEYA 253 S G GYDLS TTFSPDGRVFQVEYA Sbjct: 1 SIGTGYDLSSTTFSPDGRVFQVEYA 25
>PSA3_CAEEL (Q09583) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome| subunit alpha 7) Length = 249 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +2 Query: 176 SSKGXGYDLSVTTFSPDGRVFQVEYA 253 SS G GYDL+ +TFSPDGR+FQVEYA Sbjct: 1 SSIGTGYDLAASTFSPDGRIFQVEYA 26
>PSA3_DICDI (Q27563) Proteasome subunit alpha type 3 (EC 3.4.25.1)| Length = 248 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS G GYDL V+T+SPDG++FQV+YA Sbjct: 1 MSSVGSGYDLYVSTYSPDGKLFQVDYA 27
>PSA3_DROME (Q9V5C6) Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S| proteasome subunit alpha-7) Length = 253 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MS+ G GYDLS + FSPDGRVFQ++YA Sbjct: 1 MSTIGTGYDLSASQFSPDGRVFQIDYA 27
>PSA3_YEAST (P21242) Proteasome component C1 (EC 3.4.25.1) (Macropain subunit| C1) (Proteinase YSCE subunit 1) (Multicatalytic endopeptidase complex subunit C1) Length = 287 Score = 41.2 bits (95), Expect = 7e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +2 Query: 176 SSKGXGYDLSVTTFSPDGRVFQVEYA 253 +S G GYDLS + FSPDGR FQVEYA Sbjct: 1 TSIGTGYDLSNSVFSPDGRNFQVEYA 26
>PSMA_METTH (O26782) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 248 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +2 Query: 182 KGXGYDLSVTTFSPDGRVFQVEYA 253 + GYD ++T FSPDGR+FQVEYA Sbjct: 5 QSAGYDRAITVFSPDGRLFQVEYA 28
>PSMA_ARCFU (O29760) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 246 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQVEYA Sbjct: 7 GYDRAITVFSPDGRLFQVEYA 27
>PSMA_METTE (Q59565) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 247 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQVEYA Sbjct: 6 GYDRAITVFSPDGRLFQVEYA 26
>PSMA_METAC (Q8TPX5) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 247 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQVEYA Sbjct: 6 GYDRAITVFSPDGRLFQVEYA 26
>PSMA_METMA (Q8PTU1) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 249 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQVEYA Sbjct: 8 GYDRAITVFSPDGRLFQVEYA 28
>PSA6B_ARATH (O81147) Proteasome subunit alpha type 6-B (EC 3.4.25.1)| (Proteasome subunit alpha type 1) (20S proteasome alpha subunit A-2) Length = 246 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +2 Query: 185 GXGYDLSVTTFSPDGRVFQVEYA 253 G GYD +T FSP+GR+FQVEYA Sbjct: 6 GAGYDRHITIFSPEGRLFQVEYA 28
>PSA6A_ARATH (O81146) Proteasome subunit alpha type 6-A (EC 3.4.25.1)| (Proteasome subunit alpha type 1) (20S proteasome alpha subunit A-1) (Proteasome component 1) Length = 246 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +2 Query: 185 GXGYDLSVTTFSPDGRVFQVEYA 253 G GYD +T FSP+GR+FQVEYA Sbjct: 6 GAGYDRHITIFSPEGRLFQVEYA 28
>PSA6_TOBAC (Q9XG77) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome alpha subunit A) (20S proteasome subunit alpha-1) Length = 246 Score = 39.3 bits (90), Expect = 0.003 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +2 Query: 185 GXGYDLSVTTFSPDGRVFQVEYA 253 G GYD +T FSP+GR+FQVEYA Sbjct: 6 GGGYDRHITIFSPEGRLFQVEYA 28
>PSMA_PYRAE (Q8ZVM1) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 243 Score = 38.9 bits (89), Expect = 0.004 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYAG 256 GYD ++T FSP+G+++QVEYAG Sbjct: 8 GYDRAITIFSPEGKIYQVEYAG 29
>PSA3_SCHPO (O59770) Probable proteasome subunit alpha type 3 (EC 3.4.25.1)| Length = 253 Score = 38.5 bits (88), Expect = 0.005 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS G GYDL + FSPDGR+FQ EYA Sbjct: 1 MSSIGTGYDLGLF-FSPDGRLFQAEYA 26
>PSA6_ORYSA (Q9LSU3) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome alpha subunit A) (20S proteasome subunit alpha-1) Length = 246 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 185 GXGYDLSVTTFSPDGRVFQVEYA 253 G GYD +T FSP+GR++QVEYA Sbjct: 6 GAGYDRHITIFSPEGRLYQVEYA 28
>PSMA_THEK1 (O24733) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 260 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQV YA Sbjct: 9 GYDRAITVFSPDGRLFQVNYA 29
>PSMA_PYRKO (Q5JIU9) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 260 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQV YA Sbjct: 9 GYDRAITVFSPDGRLFQVNYA 29
>PSMA_PYRHO (O59219) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 260 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQV YA Sbjct: 9 GYDRAITVFSPDGRLFQVNYA 29
>PSMA_PYRFU (Q8U0L6) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 260 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQV YA Sbjct: 9 GYDRAITVFSPDGRLFQVNYA 29
>PSMA_PYRAB (Q9V122) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 260 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDGR+FQV YA Sbjct: 9 GYDRAITVFSPDGRLFQVNYA 29
>PSMA_PICTO (Q6L0W3) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 234 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDGR+FQVEYA Sbjct: 8 YDRAITVFSPDGRLFQVEYA 27
>PSMA_THEVO (Q97BZ8) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 233 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDGR+FQVEYA Sbjct: 8 YDRAITVFSPDGRLFQVEYA 27
>PSMA_THEAC (P25156) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 233 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDGR+FQVEYA Sbjct: 8 YDRAITVFSPDGRLFQVEYA 27
>PSMA_METKA (Q8TYB7) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 246 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDGR+FQVEYA Sbjct: 10 YDRAITVFSPDGRLFQVEYA 29
>PSA5_TRYBB (Q9XZG5) Proteasome subunit alpha type 5 (EC 3.4.25.1) (20S| proteasome subunit alpha-5) Length = 246 Score = 37.7 bits (86), Expect = 0.008 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 M S YD V TFSP+GR+FQ+EYA Sbjct: 1 MFSSKTEYDRGVNTFSPEGRIFQIEYA 27
>PSA6_SOYBN (O48551) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit) Length = 246 Score = 37.4 bits (85), Expect = 0.010 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 185 GXGYDLSVTTFSPDGRVFQVEYA 253 G GY+ +T FSP+GR+FQVEYA Sbjct: 6 GGGYNRHITIFSPEGRLFQVEYA 28
>PSA6_SCHPO (O94517) Probable proteasome subunit alpha type 6 (EC 3.4.25.1)| Length = 244 Score = 37.4 bits (85), Expect = 0.010 Identities = 14/25 (56%), Positives = 21/25 (84%) Frame = +2 Query: 179 SKGXGYDLSVTTFSPDGRVFQVEYA 253 S+ G+D ++T FSP+GR++QVEYA Sbjct: 2 SQARGFDRTITVFSPEGRLYQVEYA 26
>PSMA_METMP (Q6M0L9) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 259 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSP+GR++QVEYA Sbjct: 9 GYDRAITIFSPEGRLYQVEYA 29
>PSA6_YEAST (P21243) Proteasome component C7-alpha (EC 3.4.25.1) (Macropain| subunit C7-alpha) (Proteinase YSCE subunit 7) (Multicatalytic endopeptidase complex C7) (Component Y8) (SCL1 suppressor protein) Length = 252 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +2 Query: 176 SSKGXGYDLSVTTFSPDGRVFQVEYA 253 ++ GYD +T FSP+GR++QVEYA Sbjct: 6 AASAAGYDRHITIFSPEGRLYQVEYA 31
>PSA7_YEAST (P40303) Proteasome component PRE6 (EC 3.4.25.1) (Macropain subunit| PRE6) (Proteinase YSCE subunit PRE6) (Multicatalytic endopeptidase complex subunit PRE6) Length = 254 Score = 36.2 bits (82), Expect = 0.023 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD +++ FSPDG +FQVEYA Sbjct: 3 GYDRALSIFSPDGHIFQVEYA 23
>PSA5_CAEEL (Q95008) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome| subunit alpha 5) Length = 248 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_RAT (P34064) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome| zeta chain) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) Length = 241 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_MOUSE (Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome| zeta chain) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) Length = 241 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_HUMAN (P28066) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome| zeta chain) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) Length = 241 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_DROME (Q95083) Proteasome subunit alpha type 5 (EC 3.4.25.1)| Length = 244 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_SOYBN (Q9M4T8) Proteasome subunit alpha type 5 (EC 3.4.25.1) (20S| proteasome alpha subunit E) (20S proteasome subunit alpha-5) Length = 237 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_SCHPO (Q9UT97) Probable proteasome subunit alpha type 5 (EC 3.4.25.1)| Length = 247 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5_ORYSA (Q9LSU1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (20S| proteasome alpha subunit E) (20S proteasome subunit alpha-5) Length = 237 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5B_ARATH (Q42134) Proteasome subunit alpha type 5-B (EC 3.4.25.1) (20S| proteasome alpha subunit E-2) (Proteasome component Z) Length = 237 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSA5A_ARATH (O81149) Proteasome subunit alpha type 5-A (EC 3.4.25.1) (20S| proteasome alpha subunit E-1) Length = 237 Score = 36.2 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V TFSP+GR+FQVEYA Sbjct: 8 YDRGVNTFSPEGRLFQVEYA 27
>PSMA_HALSA (P57697) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 253 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD +T FSPDGR++QVEYA Sbjct: 10 YDRGITIFSPDGRLYQVEYA 29
>PSA6_CAEEL (O17586) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome| subunit alpha 1) Length = 246 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 G+D +T FSP+GRV+QVEYA Sbjct: 8 GFDRHITIFSPEGRVYQVEYA 28
>PSMA1_HALVO (Q9V2V6) Proteasome alpha-1 subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha-1 subunit) Length = 252 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD +T FSPDGR++QVEYA Sbjct: 10 YDRGITIFSPDGRLYQVEYA 29
>PSMA1_HALMA (Q5V2X8) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 260 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD +T FSPDGR++QVEYA Sbjct: 10 YDRGITIFSPDGRLYQVEYA 29
>PSA7_LYCES (O24030) Proteasome subunit alpha type 7 (EC 3.4.25.1) (20S| proteasome alpha subunit D) (20S proteasome subunit alpha-4) Length = 259 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 4 YDRAITVFSPDGHLFQVEYA 23
>PSMA2_HALMA (Q5V1D4) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 244 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD +T FSPDGR++QVEYA Sbjct: 9 YDRGITIFSPDGRLYQVEYA 28
>PSA7_TRYBB (Q9NDA2) Proteasome subunit alpha type 7 (EC 3.4.25.1) (20S| proteasome subunit alpha-4) Length = 247 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA7B_XENLA (Q9PVQ1) Proteasome subunit alpha type 7-B (EC 3.4.25.1)| (Proteasome subunit alpha 4-B) Length = 247 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA71_DROVI (O16811) Proteasome subunit alpha type 7-1 (EC 3.4.25.1)| (Proteasome 28 kDa subunit 1) Length = 247 Score = 35.8 bits (81), Expect = 0.030 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS+ YD +VT FSPDGR+ QVEYA Sbjct: 1 MSSR---YDRAVTIFSPDGRLLQVEYA 24
>PSA7_DICDI (P34120) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome| component DD5) Length = 250 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 6 YDRAITVFSPDGHLFQVEYA 25
>PSA7L_MOUSE (Q9CWH6) Proteasome subunit alpha type 7-like (EC 3.4.25.1)| Length = 250 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 5 YDRAITVFSPDGHLFQVEYA 24
>PSA7B_ARATH (O24616) Proteasome subunit alpha type 7-B (EC 3.4.25.1)| (Proteasome subunit alpha type 4) (20S proteasome alpha subunit D-2) (Proteasome component 6B) (Proteasome component 6C) Length = 250 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 4 YDRAITVFSPDGHLFQVEYA 23
>PSA7A_ARATH (P30186) Proteasome subunit alpha type 7-A (EC 3.4.25.1)| (Proteasome subunit alpha type 4) (20S proteasome alpha subunit D-1) (TAS-G64) (Proteasome component 6A) Length = 250 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 4 YDRAITVFSPDGHLFQVEYA 23
>PSA7_CICAR (Q9SXU1) Proteasome subunit alpha type 7 (EC 3.4.25.1) (20S| proteasome alpha subunit D) (20S proteasome subunit alpha-4) Length = 249 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 4 YDRAITVFSPDGHLFQVEYA 23
>PSA7_CHICK (O13268) Proteasome subunit alpha type 7 (EC 3.4.25.1) (GPRO-28)| Length = 249 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA7_RAT (P48004) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome| subunit RC6-1) Length = 254 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA7L_HUMAN (Q8TAA3) Proteasome subunit alpha type 7-like (EC 3.4.25.1)| Length = 256 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 5 YDRAITVFSPDGHLFQVEYA 24
>PSA7_CARAU (Q9PTW9) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome| subunit alpha 4) Length = 251 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 5 YDRAITVFSPDGHLFQVEYA 24
>PSA7_ORYSA (O04861) Proteasome subunit alpha type 7 (EC 3.4.25.1) (20S| proteasome alpha subunit D) (20S proteasome subunit alpha-4) Length = 248 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 4 YDRAITVFSPDGHLFQVEYA 23
>PSA7_MOUSE (Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome| subunit RC6-1) Length = 248 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA7_HUMAN (O14818) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome| subunit RC6-1) (Proteasome subunit XAPC7) Length = 248 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA7A_XENLA (Q9PVY6) Proteasome subunit alpha type 7-A (EC 3.4.25.1)| (Proteasome subunit alpha 4-A) Length = 248 Score = 35.8 bits (81), Expect = 0.030 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 3 YDRAITVFSPDGHLFQVEYA 22
>PSA7_CAEEL (Q95005) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome| subunit alpha 4) Length = 253 Score = 35.4 bits (80), Expect = 0.039 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSPDG +FQVEYA Sbjct: 4 YDRAITIFSPDGHLFQVEYA 23
>PSA1A_ARATH (P34066) Proteasome subunit alpha type 1-A (EC 3.4.25.1)| (Proteasome subunit alpha type 6) (20S proteasome alpha subunit F-1) (Proteasome 30 kDa subunit) (Proteasome component 2A) (AtPSM30) Length = 278 Score = 35.4 bits (80), Expect = 0.039 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VTT+SP GR+FQVEYA Sbjct: 6 YDTDVTTWSPTGRLFQVEYA 25
>PSA5_YEAST (P32379) Proteasome component PUP2 (EC 3.4.25.1) (Macropain subunit| PUP2) (Proteinase YSCE subunit PUP2) (Multicatalytic endopeptidase complex subunit PUP2) Length = 260 Score = 35.4 bits (80), Expect = 0.039 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD V+TFSP+GR+FQVEY+ Sbjct: 8 YDRGVSTFSPEGRLFQVEYS 27
>PSMA_SULAC (Q4JB24) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 242 Score = 35.4 bits (80), Expect = 0.039 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 167 LTMSSKGXGYDLSVTTFSPDGRVFQVEYA 253 + + GYD ++T FSPDG ++QV+YA Sbjct: 1 MALGPAAMGYDRAITIFSPDGSLYQVDYA 29
>PSA1B_ARATH (O23712) Proteasome subunit alpha type 1-B (EC 3.4.25.1)| (Proteasome subunit alpha type 6) (20S proteasome alpha subunit F-2) (Proteasome component 2B) Length = 277 Score = 35.4 bits (80), Expect = 0.039 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VTT+SP GR+FQVEYA Sbjct: 6 YDTDVTTWSPTGRLFQVEYA 25
>PSA1_ORYSA (P52428) Proteasome subunit alpha type 1 (EC 3.4.25.1) (20S| proteasome alpha subunit F) (20S proteasome subunit alpha-6) (Proteasome component C2) Length = 270 Score = 35.0 bits (79), Expect = 0.051 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VTT+SP GR+FQVEYA Sbjct: 6 YDTDVTTWSPAGRLFQVEYA 25
>PSMA_SULTO (Q975G5) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 242 Score = 35.0 bits (79), Expect = 0.051 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDG ++QV+YA Sbjct: 9 GYDRAITIFSPDGSLYQVDYA 29
>PSMA_METJA (Q60177) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) (20S proteasome alpha subunit) Length = 261 Score = 35.0 bits (79), Expect = 0.051 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD ++T FSP+GR++QVEYA Sbjct: 9 YDRAITVFSPEGRLYQVEYA 28
>PSMA_SULSO (Q9UXC6) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 241 Score = 35.0 bits (79), Expect = 0.051 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GYD ++T FSPDG ++QV+YA Sbjct: 9 GYDRAITIFSPDGSLYQVDYA 29
>PSA6_DROME (Q9XZJ4) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome subunit alpha-1) Length = 244 Score = 34.7 bits (78), Expect = 0.066 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 G+D +T FSP+GR++QVEYA Sbjct: 8 GFDRHITIFSPEGRLYQVEYA 28
>PSA6_RAT (P60901) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome| iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) Length = 246 Score = 34.7 bits (78), Expect = 0.066 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 G+D +T FSP+GR++QVEYA Sbjct: 8 GFDRHITIFSPEGRLYQVEYA 28
>PSA6_MOUSE (Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome| iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) Length = 246 Score = 34.7 bits (78), Expect = 0.066 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 G+D +T FSP+GR++QVEYA Sbjct: 8 GFDRHITIFSPEGRLYQVEYA 28
>PSA6_HUMAN (P60900) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome| iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) (27 kDa prosomal protein) (PROS-27) (p27K) Length = 246 Score = 34.7 bits (78), Expect = 0.066 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 G+D +T FSP+GR++QVEYA Sbjct: 8 GFDRHITIFSPEGRLYQVEYA 28
>PSA1_DICDI (Q27562) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| subunit C2) Length = 248 Score = 34.7 bits (78), Expect = 0.066 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD +TTFSP GR+ Q+EYA Sbjct: 6 YDSDITTFSPSGRIHQIEYA 25
>PSA2_XENLA (P24495) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome| component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) (xC3) Length = 233 Score = 34.3 bits (77), Expect = 0.086 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GY S+TTFSP G++ Q+EYA Sbjct: 4 GYSFSLTTFSPSGKLVQIEYA 24
>PSA2_RAT (P17220) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome| component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) Length = 233 Score = 34.3 bits (77), Expect = 0.086 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GY S+TTFSP G++ Q+EYA Sbjct: 4 GYSFSLTTFSPSGKLVQIEYA 24
>PSA2_MOUSE (P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome| component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) Length = 233 Score = 34.3 bits (77), Expect = 0.086 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GY S+TTFSP G++ Q+EYA Sbjct: 4 GYSFSLTTFSPSGKLVQIEYA 24
>PSA2_HUMAN (P25787) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome| component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) Length = 233 Score = 34.3 bits (77), Expect = 0.086 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GY S+TTFSP G++ Q+EYA Sbjct: 4 GYSFSLTTFSPSGKLVQIEYA 24
>PSA2_CARAU (O73672) Proteasome subunit alpha type 2 (EC 3.4.25.1)| Length = 233 Score = 34.3 bits (77), Expect = 0.086 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 GY S+TTFSP G++ Q+EYA Sbjct: 4 GYSFSLTTFSPSGKLVQIEYA 24
>PSA1_TRYCR (P92188) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| 29 kDa subunit) (TCPR29) Length = 265 Score = 34.3 bits (77), Expect = 0.086 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD + TT+SP GR+FQVEYA Sbjct: 6 YDTNTTTWSPTGRLFQVEYA 25
>PSA1_TRYBR (O96788) Proteasome subunit alpha type 1 (EC 3.4.25.1) (20S| proteasome subunit alpha-6) Length = 266 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD TT+SP GR+FQVEYA Sbjct: 6 YDTDTTTWSPTGRLFQVEYA 25
>PSA7_SCHPO (Q10329) Probable proteasome subunit alpha type 7 (EC 3.4.25.1)| Length = 259 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEY 250 GYD +++ FSPDGR+ QVEY Sbjct: 3 GYDRALSVFSPDGRLLQVEY 22
>PSA4_DICDI (P34119) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| component DD4) Length = 250 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GRV+QVEYA Sbjct: 5 YDQRTTIFSPEGRVYQVEYA 24
>PSMA2_HALVO (Q9V2V5) Proteasome alpha-2 subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha-2 subunit) Length = 249 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD + FSPDGR++QVEYA Sbjct: 9 YDRGTSLFSPDGRIYQVEYA 28
>PSA71_DROME (P22769) Proteasome subunit alpha type 7-1 (EC 3.4.25.1)| (Proteasome 28 kDa subunit 1) (PROS-Dm28.1) Length = 249 Score = 33.9 bits (76), Expect = 0.11 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS+ YD +VT FSPDG + QVEYA Sbjct: 1 MSSR---YDRAVTIFSPDGHLLQVEYA 24
>PSA2_CAEEL (Q27488) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome| subunit alpha 2) Length = 231 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 185 GXGYDLSVTTFSPDGRVFQVEYA 253 G Y S+TTFSP G++ Q+EYA Sbjct: 2 GDHYGFSLTTFSPSGKLMQIEYA 24
>PSA4_DROME (P18053) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| 29 kDa subunit) (PROS-Dm29) Length = 264 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_RAT (P21670) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| component C9) (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome subunit L) Length = 261 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_MOUSE (Q9R1P0) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| component C9) (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome subunit L) Length = 261 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_MACFA (Q4R932) Proteasome subunit alpha type 4 (EC 3.4.25.1)| Length = 261 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_HUMAN (P25789) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| component C9) (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome subunit L) Length = 261 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA1_YEAST (P40302) Proteasome component PRE5 (EC 3.4.25.1) (Macropain subunit| PRE5) (Proteinase YSCE subunit PRE5) (Multicatalytic endopeptidase complex subunit PRE5) Length = 234 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD TFSP GR+FQVEYA Sbjct: 6 YDGDTVTFSPTGRLFQVEYA 25
>PSA4_SCHPO (Q09682) Probable proteasome subunit alpha type 4 (EC 3.4.25.1)| Length = 248 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_YEAST (P23638) Proteasome component Y13 (EC 3.4.25.1) (Macropain subunit| Y13) (Proteinase YSCE subunit 13) (Multicatalytic endopeptidase complex subunit Y13) Length = 258 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 6 YDSRTTIFSPEGRLYQVEYA 25
>PSA4_SPIOL (P52427) Proteasome subunit alpha type 4 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit alpha-3) (Proteasome 27 kDa subunit) Length = 250 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_ORYSA (Q9LE92) Proteasome subunit alpha type 4 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit alpha-3) Length = 250 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_CAEEL (Q9N599) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| subunit alpha 3) Length = 250 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_ARATH (O81148) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| subunit alpha type 3) (20S proteasome alpha subunit C-1) (Proteasome 27 kDa subunit) (Proteasome component 9) Length = 250 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA4_PETHY (O82530) Proteasome subunit alpha type 4 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit alpha-3) Length = 249 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD T FSP+GR++QVEYA Sbjct: 5 YDSRTTIFSPEGRLYQVEYA 24
>PSA1_TRYBB (Q9GU37) Proteasome subunit alpha type 1 (EC 3.4.25.1) (20SPA1)| Length = 266 Score = 32.3 bits (72), Expect = 0.33 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 191 GYDLSVTTFSPDGRVFQVEYA 253 G+D +T FSP+G ++QVEYA Sbjct: 5 GFDKYITVFSPEGSLYQVEYA 25
>PSA73_DROME (Q27575) Proteasome subunit alpha type 7-1B (EC 3.4.25.1)| (Testis-specific proteasome 28 kDa subunit 1B) (Testis-specific alpha4-t2 proteasome subunit) Length = 252 Score = 32.3 bits (72), Expect = 0.33 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD +VT +SPDG + QVEYA Sbjct: 5 YDRAVTIYSPDGHLLQVEYA 24
>PSA2_NEUCR (Q8X077) Probable proteasome subunit alpha type 2 (EC 3.4.25.1)| Length = 249 Score = 32.0 bits (71), Expect = 0.43 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP G++ Q+EYA Sbjct: 5 YSFSLTTFSPSGKLVQIEYA 24
>PSA2_SCHPO (O94579) Probable proteasome subunit alpha type 2 (EC 3.4.25.1)| Length = 245 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP+G++ Q+EYA Sbjct: 5 YAFSLTTFSPNGKLVQIEYA 24
>PSA2_DROME (P40301) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome| 25 kDa subunit) (PROS-Dm25) Length = 234 Score = 31.2 bits (69), Expect = 0.73 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP G++ Q+EYA Sbjct: 6 YSFSLTTFSPSGKLVQLEYA 25
>PSA4L_DROME (Q9VA12) Proteasome subunit alpha type 4-like (EC 3.4.25.1)| Length = 251 Score = 31.2 bits (69), Expect = 0.73 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 +D T FSP+GR++QVEYA Sbjct: 5 FDSRTTIFSPEGRLYQVEYA 24
>PSA1_RAT (P18420) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) Length = 263 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ Q+EYA Sbjct: 6 YDNDVTVWSPQGRIHQIEYA 25
>PSA1_PONPY (Q5REN2) Proteasome subunit alpha type 1 (EC 3.4.25.1)| Length = 263 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ Q+EYA Sbjct: 6 YDNDVTVWSPQGRIHQIEYA 25
>PSA1_MOUSE (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) Length = 263 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ Q+EYA Sbjct: 6 YDNDVTVWSPQGRIHQIEYA 25
>PSA1_MACFA (Q4R3H2) Proteasome subunit alpha type 1 (EC 3.4.25.1)| Length = 263 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ Q+EYA Sbjct: 6 YDNDVTVWSPQGRIHQIEYA 25
>PSA1_HUMAN (P25786) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) (30 kDa prosomal protein) (PROS-30) Length = 263 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ Q+EYA Sbjct: 6 YDNDVTVWSPQGRIHQIEYA 25
>PSA1_DROME (P12881) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| 35 kDa subunit) (PROS-Dm35) Length = 279 Score = 30.8 bits (68), Expect = 0.95 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ QVEYA Sbjct: 6 YDSDVTVWSPQGRLHQVEYA 25
>PSA1_SCHPO (O14250) Probable proteasome subunit alpha type 1 (EC 3.4.25.1)| Length = 272 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD TT+SP GR+ QVEYA Sbjct: 6 YDGDATTWSPQGRLHQVEYA 25
>PSA2_ORYSA (Q9LSU2) Proteasome subunit alpha type 2 (EC 3.4.25.1) (20S| proteasome alpha subunit B) (20S proteasome subunit alpha-2) Length = 235 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP G++ Q+E+A Sbjct: 6 YSFSLTTFSPSGKLVQIEHA 25
>PSA2B_ARATH (Q8L4A7) Proteasome subunit alpha type 2-B (EC 3.4.25.1) (20S| proteasome alpha subunit B-2) Length = 235 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP G++ Q+E+A Sbjct: 6 YSFSLTTFSPSGKLVQIEHA 25
>PSA2A_ARATH (O23708) Proteasome subunit alpha type 2-A (EC 3.4.25.1) (20S| proteasome alpha subunit B) (Proteasome component 3) Length = 235 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP G++ Q+E+A Sbjct: 6 YSFSLTTFSPSGKLVQIEHA 25
>PSA5_ENTHI (Q94561) Proteasome subunit alpha type 5 (EC 3.4.25.1)| Length = 247 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 197 DLSVTTFSPDGRVFQVEYA 253 D V TFS +GR+FQVEYA Sbjct: 9 DHGVNTFSSEGRLFQVEYA 27
>PSA1_CAEEL (O44156) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome| subunit alpha 6) Length = 260 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 YD VT +SP GR+ QVEYA Sbjct: 6 YDGDVTVWSPQGRLHQVEYA 25
>PSA2_YEAST (P23639) Proteasome component Y7 (EC 3.4.25.1) (Macropain subunit| Y7) (Proteinase YSCE subunit 7) (Multicatalytic endopeptidase complex subunit Y7) Length = 250 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 194 YDLSVTTFSPDGRVFQVEYA 253 Y S+TTFSP G++ Q++YA Sbjct: 5 YSFSLTTFSPSGKLGQIDYA 24
>PSA72_DROME (Q24178) Proteasome subunit alpha type 7-1A (EC 3.4.25.1)| (Testis-specific proteasome 28 kDa subunit 1A) (Testis-specific alpha4-t1 proteasome subunit) Length = 249 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +2 Query: 173 MSSKGXGYDLSVTTFSPDGRVFQVEYA 253 MSS+ Y ++T FSPDG + QVEYA Sbjct: 1 MSSR---YGRALTIFSPDGHLLQVEYA 24
>PSMA_AERPE (Q9YC01) Proteasome alpha subunit (EC 3.4.25.1) (Multicatalytic| endopeptidase complex alpha subunit) Length = 258 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 161 LVLTMSSKGXGYDLSVTTFSPDGRVFQVEYA 253 + M YD + T FSP+G ++QV YA Sbjct: 1 MAFPMPPHQTAYDRAATIFSPEGDLYQVRYA 31
>PSA2_TRYBB (Q9U793) Proteasome subunit alpha type 2 (EC 3.4.25.1) (20S| proteasome subunit alpha-2) Length = 231 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 206 VTTFSPDGRVFQVEYA 253 +TTFSP GR+ Q+EYA Sbjct: 8 LTTFSPSGRLVQIEYA 23
>LTBP2_BOVIN (Q28019) Latent transforming growth factor beta-binding protein 2| precursor (LTBP-2) Length = 1842 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 255 PAYSTWKTRPSGEKVVTDRSYPXPLLLMVKTKSR 154 P TW++RPSG++ R+ P L ++T R Sbjct: 116 PPAQTWRSRPSGQQQSAPRARAAPALPRLETVQR 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,465,403 Number of Sequences: 219361 Number of extensions: 206173 Number of successful extensions: 790 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)