| Clone Name | bart07d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | C14AA_BACTS (Q45710) Pesticidal crystal protein cry14Aa (Insecti... | 35 | 0.13 | 2 | VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous... | 30 | 3.2 | 3 | CSE1_ARATH (Q9ZPY7) Importin-alpha re-exporter (Cellular apoptos... | 29 | 5.4 |
|---|
>C14AA_BACTS (Q45710) Pesticidal crystal protein cry14Aa (Insecticidal| delta-endotoxin CryXIVA(a)) (Crystaline entomocidal protoxin) (132 kDa crystal protein) Length = 1186 Score = 34.7 bits (78), Expect = 0.13 Identities = 20/72 (27%), Positives = 34/72 (47%) Frame = +3 Query: 204 GPYGLFSAADLSCAFGLADSTLNGTIQNHLWPQSPNLGARHPAVSTTIESQSSIYAAAGP 383 GP + + A ++C D G +H + S ++GA HP ++ IE I + G Sbjct: 885 GPLPITADASITCCAPEIDQCDGGQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGY 944 Query: 384 TSATNLSIXESQ 419 + +NL I E + Sbjct: 945 ITISNLEIIEER 956
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 30.0 bits (66), Expect = 3.2 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 Query: 266 PQWNHSESPVASVPEPRRAASRGLHDNRVAVVNLCSGGSHVSD 394 P WNH+ P A P R A GL D +V + G H+SD Sbjct: 164 PPWNHALLPAAFYPAALRNALPGLFDAKVP--SSQRSGFHISD 204
>CSE1_ARATH (Q9ZPY7) Importin-alpha re-exporter (Cellular apoptosis| susceptibility protein homolog) Length = 972 Score = 29.3 bits (64), Expect = 5.4 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Frame = +2 Query: 293 VASVPEPRRAASRGLHDNR------VAVVNLCSGGSHVSDQSEHXREPSFRRHER 439 ++ +PEPRR A R L D +AV+ L + + + +Q+ H +F+ H R Sbjct: 19 LSPIPEPRRTAERALSDAADQANYGLAVLRLVAEPA-IDEQTRHAAAVNFKNHLR 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,906,178 Number of Sequences: 219361 Number of extensions: 554875 Number of successful extensions: 1855 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1854 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)