| Clone Name | bart07c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TGA1A_TOBAC (P14232) TGACG-sequence-specific DNA-binding protein... | 31 | 2.1 | 2 | K1C13_ONCMY (Q8JFQ6) Keratin, type I cytoskeletal 13 (Cytokerati... | 29 | 6.0 |
|---|
>TGA1A_TOBAC (P14232) TGACG-sequence-specific DNA-binding protein TGA-1A (TGA1a)| (ASF-1 protein) Length = 359 Score = 30.8 bits (68), Expect = 2.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 147 KESRGSGGGVDQTMRTSRGAMGFGSSYFSLPFGRWSESGT 28 K+ GGGVD + + G G++ F + +G W E T Sbjct: 119 KQGMCVGGGVDASQLSYSGTASSGTAVFDMEYGHWVEEQT 158
>K1C13_ONCMY (Q8JFQ6) Keratin, type I cytoskeletal 13 (Cytokeratin-13) (CK-13)| (Keratin-13) (K13) Length = 492 Score = 29.3 bits (64), Expect = 6.0 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 141 SRGSGGGVDQTMRTSRGA-MGFGSSYFSLPFGRWSESGTGEAGG 13 S G GGG +MR+ G MG GSS FS S G G GG Sbjct: 13 SGGGGGGGTMSMRSGGGGGMGMGSSRFS------SMGGGGGGGG 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,498,816 Number of Sequences: 219361 Number of extensions: 460898 Number of successful extensions: 1629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1628 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)