Clone Name | bart06h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemota... | 29 | 5.2 | 2 | DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7) | 29 | 6.8 |
---|
>MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemotaxis protein)| Length = 657 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -1 Query: 191 TSAAASD*SSWVRRTAXGGPWSSEVVSRTR 102 T+AA + ++ VRRTA G +S+VVS TR Sbjct: 386 TAAALDELTATVRRTAAGARQASDVVSTTR 415
>DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1073 Score = 28.9 bits (63), Expect = 6.8 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 307 GISHHRGAFSGPGEVRDHPAFDVVPTELAR 396 G H G SG + D P DVVPTE AR Sbjct: 525 GQPRHLGIHSGGMVICDRPIADVVPTEWAR 554 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,896,141 Number of Sequences: 219361 Number of extensions: 526640 Number of successful extensions: 1549 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1549 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)