Clone Name | bart06f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLO2_BUCAI (P57336) Probable hydroxyacylglutathione hydrolase (E... | 29 | 8.5 |
---|
>GLO2_BUCAI (P57336) Probable hydroxyacylglutathione hydrolase (EC 3.1.2.6)| (Glyoxalase II) (GLX II) Length = 251 Score = 28.9 bits (63), Expect = 8.5 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Frame = +3 Query: 324 HIRGHIP------LLCGGDLAVRGRPRDRVGIHHQILQDIGILACKGDATDICCCHD 476 H GH+ + CG L G R H ++ + I I++ D+T +CC H+ Sbjct: 110 HTSGHVSYYSQPYIFCGDTLFSAGCGRVFKNKHLEMYRSIKIISSLPDSTLLCCSHE 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,050,160 Number of Sequences: 219361 Number of extensions: 976113 Number of successful extensions: 2613 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2613 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)