Clone Name | bart06d01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF3_NEIMB (P65138) Translation initiation factor IF-3 | 30 | 4.3 | 2 | IF3_NEIMA (P65137) Translation initiation factor IF-3 | 30 | 4.3 | 3 | CP2K1_ONCMY (Q92090) Cytochrome P450 2K1 (EC 1.14.14.1) (CYPIIK1... | 29 | 9.6 |
---|
>IF3_NEIMB (P65138) Translation initiation factor IF-3| Length = 173 Score = 30.0 bits (66), Expect = 4.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 318 LSPSMNQEVCXR*QHGHYRIQQAREEEVASEN*KQ 214 +SP+ VC +G Y+ QQA++ + A +N KQ Sbjct: 51 ISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQKQ 85
>IF3_NEIMA (P65137) Translation initiation factor IF-3| Length = 173 Score = 30.0 bits (66), Expect = 4.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 318 LSPSMNQEVCXR*QHGHYRIQQAREEEVASEN*KQ 214 +SP+ VC +G Y+ QQA++ + A +N KQ Sbjct: 51 ISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQKQ 85
>CP2K1_ONCMY (Q92090) Cytochrome P450 2K1 (EC 1.14.14.1) (CYPIIK1) (P450 LMC2)| Length = 504 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 370 KENLKEGKKLQLELVLSLKRXTGHHLCPSLIMTFXMRYQS 489 K+N+ + K +ELV LK H+C + +F +R Q+ Sbjct: 245 KKNIADMKMEVIELVRGLKETLNPHMCRGFVDSFLVRKQT 284 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,091,246 Number of Sequences: 219361 Number of extensions: 723115 Number of successful extensions: 2225 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2222 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)