| Clone Name | basd27o24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAR1_KLULA (Q6CQE5) Protein TAR1 | 41 | 0.002 | 2 | TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to riboso... | 41 | 0.002 | 3 | SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (S... | 28 | 8.9 |
|---|
>TAR1_KLULA (Q6CQE5) Protein TAR1| Length = 109 Score = 40.8 bits (94), Expect = 0.002 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 461 FTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 363 FT++FT FFS F H T SLSV+++YLAL G Sbjct: 12 FTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 44
>TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to ribosomal RNA| protein 1) Length = 124 Score = 40.8 bits (94), Expect = 0.002 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 461 FTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 363 FT++FT FFS F H T SLSV+++YLAL G Sbjct: 27 FTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 59
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 150 SDSRSSGERNGSSLNRENGVVGEQYKRCAARRSG*VPHPR 269 S SRS G R+ +R+ G +Y R ARR G VP R Sbjct: 412 SRSRSRGRRHSDGGSRD----GHRYSRSPARRGGYVPRRR 447 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,049,105 Number of Sequences: 219361 Number of extensions: 1222098 Number of successful extensions: 2484 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2484 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)