| Clone Name | basd27o05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GPC2_RAT (P51653) Glypican-2 precursor (Cerebroglycan) (HSPG M13) | 34 | 0.25 | 2 | GPC2_MOUSE (Q8BKV1) Glypican-2 precursor | 34 | 0.33 | 3 | VCY1_HUMAN (O14598) Testis-specific basic protein Y 1 (Variably ... | 32 | 1.3 |
|---|
>GPC2_RAT (P51653) Glypican-2 precursor (Cerebroglycan) (HSPG M13)| Length = 579 Score = 34.3 bits (77), Expect = 0.25 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 26 GGRKVQRGWGAKRNPFIPPVSEASPRPPFPSRLDGEGLPG 145 GG++ W A P +PP PRPP P R DG G+ G Sbjct: 502 GGQQYADDWKAGAAPVVPPA--RPPRPPRPPRRDGLGVRG 539
>GPC2_MOUSE (Q8BKV1) Glypican-2 precursor| Length = 579 Score = 33.9 bits (76), Expect = 0.33 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 26 GGRKVQRGWGAKRNPFIPPVSEASPRPPFPSRLDGEGLPG 145 GG++ W A P +PP PRPP P R DG G+ G Sbjct: 502 GGQQYADDWKAGAVPVVPPA--RPPRPPRPPRRDGLGVRG 539
>VCY1_HUMAN (O14598) Testis-specific basic protein Y 1 (Variably charged| protein Y) Length = 125 Score = 32.0 bits (71), Expect = 1.3 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 14 ERVRGGRKVQRGWGAKRNPFIPPVSEASPRPPFPSRLDGEGLP 142 E VRGGR+ ++G K P +E+ P P PS + LP Sbjct: 43 EAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELP 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,757,918 Number of Sequences: 219361 Number of extensions: 722750 Number of successful extensions: 2920 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2915 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)