| Clone Name | basd27n03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (S... | 28 | 4.4 | 2 | DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED ... | 28 | 5.8 | 3 | YR705_MIMIV (Q5UNW3) Hypothetical protein R705 | 27 | 9.9 | 4 | TPR_HUMAN (P12270) Nucleoprotein TPR | 27 | 9.9 |
|---|
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +1 Query: 196 SDSRSSGERNGSSLNRENGVVGEQYKRCAARRSG*VPHPR 315 S SRS G R+ +R+ G +Y R ARR G VP R Sbjct: 412 SRSRSRGRRHSDGGSRD----GHRYSRSPARRGGYVPRRR 447
>DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED RESPONSE TO| GRAVITY) (AtARG1) (AtJ15) (AtDjB15) Length = 410 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 145 DNLAN*NILVARGKESKSDSRSSGERNGSSLNRE 246 +NL+N + A+G ESK D S+GE G+ NR+ Sbjct: 359 NNLSNGSSSKAQGDESKGDGDSAGEEGGTE-NRD 391
>YR705_MIMIV (Q5UNW3) Hypothetical protein R705| Length = 313 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 190 SKSDSRSSGERNGSSLNRENGVVGEQYKRCAARRSG 297 S+S S SSG ++G S N +G G + RSG Sbjct: 255 SRSRSGSSGSKSGRSRNSRSGTSGRSSNSRSGSRSG 290
>TPR_HUMAN (P12270) Nucleoprotein TPR| Length = 2349 Score = 27.3 bits (59), Expect = 9.9 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +2 Query: 14 GTQXTRKGVASDEMLRGVENKHRSGDSQ-IGQPFKLPAESMSRQETTWRTETS**PEEKK 190 G T G ++E + G E HR+ DSQ G+ AES QE + + S E + Sbjct: 1994 GGDGTDPGTETEESMGGGEGNHRAADSQNSGEGNTGAAESSFSQEVSREQQPSSASERQA 2053 Query: 191 AKA 199 +A Sbjct: 2054 PRA 2056 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,455,953 Number of Sequences: 219361 Number of extensions: 653730 Number of successful extensions: 1504 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)