| Clone Name | basd27m09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLTL5_HUMAN (Q7Z4T8) Putative polypeptide N-acetylgalactosaminyl... | 28 | 7.8 |
|---|
>GLTL5_HUMAN (Q7Z4T8) Putative polypeptide| N-acetylgalactosaminyltransferase-like protein 5 (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase 15) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15) (Polypeptide GalNAc transferase 15) (Ga Length = 443 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 163 GGQAVLISGSSNGKSNMSVLPEPYATIGAMTHSFIRAV 276 GGQ +I S G + +P I AMTH+++R V Sbjct: 347 GGQLFIIPCSRVGHISKKQTGKPSTIISAMTHNYLRLV 384 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,765,366 Number of Sequences: 219361 Number of extensions: 434743 Number of successful extensions: 1321 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)