| Clone Name | basd27k20 |
|---|---|
| Clone Library Name | barley_pub |
>CLH_DICDI (P25870) Clathrin heavy chain| Length = 1694 Score = 45.8 bits (107), Expect = 5e-05 Identities = 17/28 (60%), Positives = 26/28 (92%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDLVKD 86 NN+L+++FPYL+Q+++EYT+KVD LV D Sbjct: 1590 NNILNYSFPYLIQYVKEYTTKVDQLVDD 1617
>CLH_DROME (P29742) Clathrin heavy chain| Length = 1678 Score = 37.7 bits (86), Expect = 0.014 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDL 77 + ++DFA PYL+Q +REYT+KVD L Sbjct: 1590 HKIVDFAMPYLIQVLREYTTKVDKL 1614
>CLH2_HUMAN (P53675) Clathrin heavy chain 2 (CLH-22)| Length = 1640 Score = 36.2 bits (82), Expect = 0.041 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDLVKDRIES 98 +N++D A PY +Q +REY SKVD L D +ES Sbjct: 1589 HNLVDLAMPYFIQVMREYLSKVDKL--DALES 1618
>RX_MOUSE (O35602) Retinal homeobox protein Rx (Retina and anterior neural| fold homeobox protein) Length = 342 Score = 35.4 bits (80), Expect = 0.070 Identities = 32/91 (35%), Positives = 37/91 (40%), Gaps = 14/91 (15%) Frame = -2 Query: 396 PSASAEIFHIICTLQIHTTEVG*LSSFPLEASRMLALDRDP----SEAYP--------SR 253 P S H I + T E G L +FP E S + +RDP A P S Sbjct: 25 PGGSTSRLHSIEAILGFTKEDGILDTFPAERSSRSSKERDPRLGAQPACPKAPAGGSESS 84 Query: 252 PLAACPFRPSEVADRPSYQAEQ--ARPEEAI 166 P AA F P A RP Y EQ ARP + Sbjct: 85 PPAAPGFVPEYEATRPCYPKEQGEARPSPGL 115
>CLH1_HUMAN (Q00610) Clathrin heavy chain 1 (CLH-17)| Length = 1674 Score = 35.0 bits (79), Expect = 0.092 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDL 77 +N++DFA PY +Q ++EY +KVD L Sbjct: 1588 HNIMDFAMPYFIQVMKEYLTKVDKL 1612
>CLH_RAT (P11442) Clathrin heavy chain| Length = 1675 Score = 35.0 bits (79), Expect = 0.092 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDL 77 +N++DFA PY +Q ++EY +KVD L Sbjct: 1589 HNIMDFAMPYFIQVMKEYLTKVDKL 1613
>CLH_MOUSE (Q68FD5) Clathrin heavy chain| Length = 1675 Score = 35.0 bits (79), Expect = 0.092 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDL 77 +N++DFA PY +Q ++EY +KVD L Sbjct: 1589 HNIMDFAMPYFIQVMKEYLTKVDKL 1613
>CLH_BOVIN (P49951) Clathrin heavy chain| Length = 1675 Score = 35.0 bits (79), Expect = 0.092 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDL 77 +N++DFA PY +Q ++EY +KVD L Sbjct: 1589 HNIMDFAMPYFIQVMKEYLTKVDKL 1613
>RX_RAT (Q9JLT7) Retinal homeobox protein Rx (Retina and anterior neural| fold homeobox protein) Length = 342 Score = 32.0 bits (71), Expect = 0.78 Identities = 31/91 (34%), Positives = 36/91 (39%), Gaps = 14/91 (15%) Frame = -2 Query: 396 PSASAEIFHIICTLQIHTTEVG*LSSFPLEASRMLALDRDP----SEAYP--------SR 253 P S H I + T E G L +FP E S + +RDP A P S Sbjct: 25 PGGSTSRLHSIEAILGFTKEDGILDTFPAERSSRGSKERDPRLGARSACPKAPAGGSESS 84 Query: 252 PLAACPFRPSEVADRPSYQAEQ--ARPEEAI 166 P AA P A RP Y EQ ARP + Sbjct: 85 PPAAPGLVPEFEATRPCYPKEQGEARPSPGL 115
>PRP28_CRYNE (Q5KNF8) Pre-mRNA splicing ATP-dependent RNA helicase PRP28 (EC| 3.6.1.-) Length = 738 Score = 32.0 bits (71), Expect = 0.78 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 206 GRSATSDGRNGHAANGRDGYASDGSRSNASIRDASNGKLLSQP 334 G +A GRN GRDGY D R RD S + S P Sbjct: 78 GYNAGPSGRNDRDGYGRDGYGRDNRRGFGDRRDGSGPAIPSGP 120
>NNP1_MOUSE (P56183) NNP-1 protein (Novel nuclear protein 1) (Nop52)| Length = 494 Score = 30.0 bits (66), Expect = 2.9 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 206 GRSATSDGRNGHAANGRDGYASDGSRSNASIRDASNGKLLSQPTS 340 G SDG +G A++G DG ASD AS D +G + S Sbjct: 241 GEGEASDGDDGEASDGDDGEASDDDDGEAS--DGGDGDVADSDDS 283 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 221 SDGRNGHAANGRDGYASDGSRSNASIRDASNG 316 SDG +G A++ DG ASDG + + D S+G Sbjct: 254 SDGDDGEASDDDDGEASDGGDGDVADSDDSDG 285
>CLH_CAEEL (P34574) Probable clathrin heavy chain protein 1| Length = 1681 Score = 29.3 bits (64), Expect = 5.0 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 3 NNMLDFAFPYLLQFIREYTSKVDDLVKDRIE 95 + ++D+A PY++Q +R+Y ++++ L + E Sbjct: 1591 HKIMDYAMPYMIQVMRDYQTRLEKLERSEHE 1621
>LRP_CAEEL (Q04833) Low-density lipoprotein receptor-related protein precursor| (LRP) Length = 4753 Score = 29.3 bits (64), Expect = 5.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -2 Query: 276 PSEAYPSRPLAACPFRPSEVADRPSYQAEQARPEEAIERTCSA 148 PSE++P+ A C R + ++ + + Q P E IE+ CS+ Sbjct: 1014 PSESHPNELEAKCACRQGFMINKENNHSCQKDPAEKIEQLCSS 1056
>TRI47_MOUSE (Q8C0E3) Tripartite motif protein 47| Length = 641 Score = 28.5 bits (62), Expect = 8.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 395 PPRQLRYFTSSVLFKFIQQRLVDSVASHW 309 PPR+L + SS + K ++ L+ + AS W Sbjct: 357 PPRELSFTKSSQVVKAVRDTLISACASQW 385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,594,929 Number of Sequences: 219361 Number of extensions: 890135 Number of successful extensions: 2674 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2669 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)