ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd26p09 |
|---|---|
| Clone Library Name | barley_pub |
>RS1_BUCAP (Q44653) 30S ribosomal protein S1| Length = 559 Score = 32.3 bits (72), Expect = 1.2 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 78 DGMLEDFSKATAVSEIISNAKTITGFLCSSALALSLMKKHLQGKDLLVPAETRAAMNFVT 257 D +LE + + I+ N F+ + L + K + P+E + + Sbjct: 183 DQLLESLQEGIEIKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDEIN 242 Query: 258 LKNMYSLKEDLQA-----MVSSDEWIHCLLPQIPGGVEVSGIVSNLQFWSSCALVVRATE 422 +K + KE + + D WI + + P G+++SG V+NL + + E Sbjct: 243 VKILKFDKERTRVSLGLKQLGEDPWI-AISNRYPEGIKLSGRVTNLTDYGCFVEIEEGVE 301 Query: 423 PLVHLLKLVGSNK 461 LVH+ ++ +NK Sbjct: 302 GLVHVSEMDWTNK 314
>RS1_SHIFL (P0AG70) 30S ribosomal protein S1| Length = 557 Score = 32.0 bits (71), Expect = 1.5 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 78 DGMLEDFSKATAVSEIISNAKTITGFLCSSALALSLMKKHLQGKDLLVPAETRAAMNFVT 257 D +LE+ + V I+ N F+ + L + K + P+E + +T Sbjct: 183 DQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDEIT 242 Query: 258 LKNMYSLKEDLQA-----MVSSDEWIHCLLPQIPGGVEVSGIVSNLQFWSSCALVVRATE 422 +K + +E + + D W+ + + P G +++G V+NL + + E Sbjct: 243 VKVLKFDRERTRVSLGLKQLGEDPWV-AIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVE 301 Query: 423 PLVHLLKLVGSNK 461 LVH+ ++ +NK Sbjct: 302 GLVHVSEMDWTNK 314
>RS1_ECOLI (P0AG67) 30S ribosomal protein S1| Length = 557 Score = 32.0 bits (71), Expect = 1.5 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 78 DGMLEDFSKATAVSEIISNAKTITGFLCSSALALSLMKKHLQGKDLLVPAETRAAMNFVT 257 D +LE+ + V I+ N F+ + L + K + P+E + +T Sbjct: 183 DQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDEIT 242 Query: 258 LKNMYSLKEDLQA-----MVSSDEWIHCLLPQIPGGVEVSGIVSNLQFWSSCALVVRATE 422 +K + +E + + D W+ + + P G +++G V+NL + + E Sbjct: 243 VKVLKFDRERTRVSLGLKQLGEDPWV-AIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVE 301 Query: 423 PLVHLLKLVGSNK 461 LVH+ ++ +NK Sbjct: 302 GLVHVSEMDWTNK 314
>RS1_ECOL6 (P0AG68) 30S ribosomal protein S1| Length = 557 Score = 32.0 bits (71), Expect = 1.5 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 78 DGMLEDFSKATAVSEIISNAKTITGFLCSSALALSLMKKHLQGKDLLVPAETRAAMNFVT 257 D +LE+ + V I+ N F+ + L + K + P+E + +T Sbjct: 183 DQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDEIT 242 Query: 258 LKNMYSLKEDLQA-----MVSSDEWIHCLLPQIPGGVEVSGIVSNLQFWSSCALVVRATE 422 +K + +E + + D W+ + + P G +++G V+NL + + E Sbjct: 243 VKVLKFDRERTRVSLGLKQLGEDPWV-AIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVE 301 Query: 423 PLVHLLKLVGSNK 461 LVH+ ++ +NK Sbjct: 302 GLVHVSEMDWTNK 314
>RS1_ECO57 (P0AG69) 30S ribosomal protein S1| Length = 557 Score = 32.0 bits (71), Expect = 1.5 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 78 DGMLEDFSKATAVSEIISNAKTITGFLCSSALALSLMKKHLQGKDLLVPAETRAAMNFVT 257 D +LE+ + V I+ N F+ + L + K + P+E + +T Sbjct: 183 DQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDEIT 242 Query: 258 LKNMYSLKEDLQA-----MVSSDEWIHCLLPQIPGGVEVSGIVSNLQFWSSCALVVRATE 422 +K + +E + + D W+ + + P G +++G V+NL + + E Sbjct: 243 VKVLKFDRERTRVSLGLKQLGEDPWV-AIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVE 301 Query: 423 PLVHLLKLVGSNK 461 LVH+ ++ +NK Sbjct: 302 GLVHVSEMDWTNK 314
>RS1_PROSP (P14128) 30S ribosomal protein S1 (Fragment)| Length = 378 Score = 32.0 bits (71), Expect = 1.5 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 78 DGMLEDFSKATAVSEIISNAKTITGFLCSSALALSLMKKHLQGKDLLVPAETRAAMNFVT 257 D +LE+ + V I+ N F+ + L + K + P+E + +T Sbjct: 78 DQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDEIT 137 Query: 258 LKNMYSLKEDLQA-----MVSSDEWIHCLLPQIPGGVEVSGIVSNLQFWSSCALVVRATE 422 +K + +E + + D W+ + + P G +++G V+NL + + E Sbjct: 138 VKVLKFDRERTRVSLGLKQLGEDPWV-AIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGVE 196 Query: 423 PLVHLLKLVGSNK 461 LVH+ ++ +NK Sbjct: 197 GLVHVSEMDWTNK 209
>SUIS_RABIT (P07768) Sucrase-isomaltase, intestinal [Contains: Sucrase (EC| 3.2.1.48); Isomaltase (EC 3.2.1.10)] Length = 1826 Score = 30.4 bits (67), Expect = 4.4 Identities = 29/94 (30%), Positives = 43/94 (45%) Frame = -3 Query: 601 SGLWMCLSHLWSIMFQ*GI*SLFFTSSFLIAALALYNPA*TYPIAGLLLLPTSLRRCTSG 422 SGL + L L+ I+F I +L + A+ NP+ + P TS TSG Sbjct: 6 SGLEITLIVLFVIVFIIAI-ALIAVLATKTPAVEEVNPSSSTPTT------TSTTTSTSG 58 Query: 421 SVARTTKAHEDQNCKLLTIPLTSTPPGICGSRQC 320 SV+ ++ +E N ++ IP S IC R C Sbjct: 59 SVSCPSELNEVVNERINCIPEQSPTQAICAQRNC 92
>NPT1_RABIT (Q28722) Renal sodium-dependent phosphate transport protein 1| (Sodium/phosphate cotransporter 1) (Na(+)/PI cotransporter 1) (Renal sodium-phosphate transport protein 1) (Renal Na(+)-dependent phosphate cotransporter 1) (Solute carrier family 1 Length = 465 Score = 30.4 bits (67), Expect = 4.4 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Frame = -3 Query: 217 SRSFPCRCFFIKLNASALLHKNPVMVFALLMISLTAVALLKSSSI-----PSMHRKVHGD 53 SR PC C F + A + N V++ + +SLT VA++ ++++ S +++ Sbjct: 7 SRKGPCFCSFRYVLALFMHFCNIVIIAQRMCLSLTMVAMVNNTNLHGSPNTSAEKRLDNT 66 Query: 52 QNSVGNVSP 26 +N V N SP Sbjct: 67 KNPVYNWSP 75
>CD22_PONPY (Q9N1E3) B-cell receptor CD22 precursor (Siglec-2) (Fragment)| Length = 330 Score = 30.0 bits (66), Expect = 5.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 51 WSPCTFRCIDGMLEDF 98 W PCT+R +DG LE F Sbjct: 39 WIPCTYRALDGALESF 54
>R13L1_ARATH (Q9LRR4) Putative disease resistance RPP13-like protein 1| Length = 1054 Score = 29.6 bits (65), Expect = 7.5 Identities = 15/62 (24%), Positives = 30/62 (48%) Frame = +3 Query: 159 CSSALALSLMKKHLQGKDLLVPAETRAAMNFVTLKNMYSLKEDLQAMVSSDEWIHCLLPQ 338 C+S +L L +HL+G + L N L + +L ++LQ +++ ++ + Q Sbjct: 957 CTSLYSLELSNEHLRGPNALRNLRINDCQNLQLLPKLNALPQNLQVTITNCRYLRQPMEQ 1016 Query: 339 IP 344 P Sbjct: 1017 QP 1018
>MNAB_HUMAN (Q9HBD1) Membrane-associated nucleic acid-binding protein (RING| finger protein 164) Length = 1191 Score = 29.3 bits (64), Expect = 9.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 528 VKKSDYMPYWNIIDQRWDKHIQRPLHSAGF 617 + SDY+PY N +D RW + SA + Sbjct: 935 ISVSDYVPYVNAVDSRWSSYGNEATSSAHY 964
>CD22_HUMAN (P20273) B-cell receptor CD22 precursor (Leu-14) (B-lymphocyte| cell adhesion molecule) (BL-CAM) (Siglec-2) Length = 847 Score = 29.3 bits (64), Expect = 9.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 51 WSPCTFRCIDGMLEDF 98 W PCT+R +DG LE F Sbjct: 41 WIPCTYRALDGDLESF 56
>CD22_GORGO (Q9N1E4) B-cell receptor CD22 precursor (Siglec-2) (Fragment)| Length = 332 Score = 29.3 bits (64), Expect = 9.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 51 WSPCTFRCIDGMLEDF 98 W PCT+R +DG LE F Sbjct: 41 WIPCTYRALDGDLESF 56
>SSB1_YEAST (P10080) Single-stranded nucleic acid-binding protein| Length = 294 Score = 29.3 bits (64), Expect = 9.8 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +3 Query: 186 MKKHLQGKDLLVPAETRAAMNFVTLKNMYSLKEDLQAMVSSDEWIHCLLPQIPGGVEVSG 365 +K+H G +PA A + F T + ++KE+ V D IH + PG ++ G Sbjct: 71 IKEHTDGH---IPASKHALVKFPTKIDFDNIKENYDTKVVKDREIHIKRARTPGQMQRGG 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,105,941 Number of Sequences: 219361 Number of extensions: 1943515 Number of successful extensions: 5192 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 5039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5184 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
