ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd27b01 |
|---|---|
| Clone Library Name | barley_pub |
>IAA14_ORYSA (Q7Y1H8) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) Length = 195 Score = 68.6 bits (166), Expect = 5e-12 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAPYLRKVDLR YGGYRELR ALDALF Sbjct: 109 LYVKVSMDGAPYLRKVDLRMYGGYRELRDALDALF 143
>IAA31_ORYSA (P0C133) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 197 Score = 60.8 bits (146), Expect = 9e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 L+VKVSMDGAPYLRK+DL+ Y GYRELR AL+A+F Sbjct: 100 LFVKVSMDGAPYLRKIDLKVYKGYRELREALEAMF 134
>IAA24_ORYSA (Q6ZL57) Auxin-responsive protein IAA24 (Indoleacetic acid-induced| protein 24) Length = 219 Score = 59.3 bits (142), Expect = 3e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAPYLRKVDL+ GYRELR ALD LF Sbjct: 130 LYVKVSMDGAPYLRKVDLKMCKGYRELREALDLLF 164
>IAA12_ORYSA (Q75GK1) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) Length = 226 Score = 58.9 bits (141), Expect = 4e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 VKVSMDGAPYLRK+DLR Y GYRELR AL+A+F Sbjct: 131 VKVSMDGAPYLRKIDLRMYKGYRELREALEAMF 163
>IAA4_PEA (P49679) Auxin-induced protein IAA4| Length = 189 Score = 57.8 bits (138), Expect = 8e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VKVSMDGAPYLRK+DLR YGGY EL AL+ +F Sbjct: 93 IFVKVSMDGAPYLRKIDLRVYGGYSELLKALETMF 127
>AX22B_PHAAU (P32294) Auxin-induced protein 22B (Indole-3-acetic acid-induced| protein ARG4) Length = 196 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VKVSMDGAPYLRKVDL+ YGGY EL AL+ +F Sbjct: 100 IFVKVSMDGAPYLRKVDLKVYGGYPELLKALETMF 134
>IAA17_ORYSA (Q75GB1) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) Length = 257 Score = 56.2 bits (134), Expect = 2e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAPYLRKVDL+TY Y++L AL+ +F Sbjct: 152 LYVKVSMDGAPYLRKVDLKTYKNYKDLSTALEKMF 186
>IAA8_ARATH (Q38826) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 321 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 L+VKVSMDGAPYLRKVDLRTY Y++L +AL+ +F Sbjct: 200 LFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMF 234
>IAA21_ORYSA (Q5Z749) Auxin-responsive protein IAA21 (Indoleacetic acid-induced| protein 21) Length = 266 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAPYLRKVDL+ Y Y+EL AL+ +F Sbjct: 147 LYVKVSMDGAPYLRKVDLKMYKNYKELSLALEKMF 181
>IAA9_ARATH (Q38827) Auxin-responsive protein IAA9 (Indoleacetic acid-induced| protein 9) Length = 338 Score = 54.3 bits (129), Expect = 9e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 L+VKVSMDGAPYLRKVDLR+Y Y EL +AL+ +F Sbjct: 217 LFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMF 251
>IAA27_ARATH (Q9ZSY8) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) (Auxin-induced protein 27) (Phytochrome-associated protein 2) Length = 305 Score = 54.3 bits (129), Expect = 9e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSM+GAPYLRK+DL+TY Y EL +AL+ +F Sbjct: 186 LYVKVSMEGAPYLRKIDLKTYKSYLELSSALEKMF 220
>IAA19_ORYSA (Q6AT33) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) Length = 281 Score = 54.3 bits (129), Expect = 9e-08 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDGAPYLRKVDL+TY Y +L AL+ +F Sbjct: 163 YVKVSMDGAPYLRKVDLKTYSSYEDLSLALEKMF 196
>IAA5_ORYSA (Q59AF3) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) Length = 271 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAPYLRKVDL+ Y Y +L AL+ +F Sbjct: 152 LYVKVSMDGAPYLRKVDLKMYSSYEDLSMALEKMF 186
>IAA3_ORYSA (Q5NB25) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) Length = 263 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAPYLRKVDL+TY Y+++ L+ +F Sbjct: 159 LYVKVSMDGAPYLRKVDLKTYKNYKDMSLGLEKMF 193
>IAA3_ARATH (Q38822) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) (Short hypocotyl) (Suppressor of HY2) Length = 189 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +YVKVSMDGAPYLRK+DL Y GY EL AL+ +F Sbjct: 93 IYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMF 127
>IAA2_ARATH (P49678) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 174 Score = 52.8 bits (125), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDGAPYLRK+DL+TY Y EL AL+ +F Sbjct: 79 YVKVSMDGAPYLRKIDLKTYKNYPELLKALENMF 112
>AUX22_SOYBN (P13088) Auxin-induced protein AUX22| Length = 195 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +YVKVSMDGAP+LRK+DL + GY +L ALD LF Sbjct: 87 MYVKVSMDGAPFLRKIDLGLHKGYSDLALALDKLF 121
>IAA13_ORYSA (Q7Y1Y5) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 236 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKVSMDGAPYLRKVDL+ Y Y++L AL +F Sbjct: 133 FVKVSMDGAPYLRKVDLKMYNSYKDLSLALQKMF 166
>IAA1_ARATH (P49677) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 168 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDGAPYLRK+DL+ Y Y EL AL+ +F Sbjct: 76 YVKVSMDGAPYLRKIDLKMYKNYPELLKALENMF 109
>AX22C_PHAAU (O24541) Auxin-induced protein 22C (Indole-3-acetic acid-induced| protein ARG12) Length = 188 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVKVSMDGAP+LRK+DL + GY +L ALD F Sbjct: 80 LYVKVSMDGAPFLRKIDLAMHKGYSDLAFALDKFF 114
>IAA30_ORYSA (P0C132) Auxin-responsive protein IAA30 (Indoleacetic acid-induced| protein 30) Length = 277 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKVSMDGAPYLRKVDL+ Y Y EL AL+ +F Sbjct: 162 FVKVSMDGAPYLRKVDLKMYKSYLELSKALEKMF 195
>IAA6_PEA (P49680) Auxin-induced protein IAA6| Length = 179 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +Y+KVSMDGAPYLRK+DL + GY EL AL+ LF Sbjct: 76 MYMKVSMDGAPYLRKIDLCLHKGYLELALALEKLF 110
>AUX28_SOYBN (P13089) Auxin-induced protein AUX28| Length = 243 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKVSMDGAPYLRKVDL+ Y YREL +L +F Sbjct: 125 FVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMF 158
>IAA17_ARATH (P93830) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) (Auxin response 3) Length = 229 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKVSMDGAPYLRK+DLR Y Y EL AL +F Sbjct: 112 FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMF 145
>IAA16_ARATH (O24407) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 236 Score = 49.3 bits (116), Expect = 3e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDGAPYLRK+DL+ Y Y++L AL +F Sbjct: 120 YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMF 153
>AX22D_PHAAU (O24542) Auxin-induced protein 22D (Indole-3-acetic acid-induced| protein ARG13) Length = 193 Score = 48.5 bits (114), Expect = 5e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +YVKVSM GAPYLRK+DL+ Y Y EL AL+ +F Sbjct: 98 MYVKVSMAGAPYLRKIDLKVYKSYPELLKALENMF 132
>IAA14_ARATH (Q38832) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) (SOLITARY-ROOT protein) Length = 228 Score = 48.5 bits (114), Expect = 5e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKVSMDGAPYLRKVDL+ Y Y++L AL +F Sbjct: 112 FVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMF 145
>IAA2_ORYSA (Q9LG86) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 238 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VK++MDG P RKVDL YGGY +L AA+D LF Sbjct: 119 MFVKINMDGVPIGRKVDLAAYGGYAQLSAAVDKLF 153
>AX22A_PHAAU (P32293) Auxin-induced protein 22A (Indole-3-acetic acid-induced| protein ARG3) Length = 194 Score = 48.1 bits (113), Expect = 6e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +YVKVSMDGAP+LRK+DL + GY +L AL+ LF Sbjct: 86 MYVKVSMDGAPFLRKMDLGMHKGYSDLAFALEKLF 120
>IAA19_ARATH (O24409) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) (MASSUGU2 protein) Length = 197 Score = 47.8 bits (112), Expect = 8e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDG PYLRK+DL + GY +L ALD LF Sbjct: 98 YVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLF 131
>IAA4_ARATH (P33077) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) (Auxin-induced protein AUX2-11) Length = 186 Score = 47.8 bits (112), Expect = 8e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDGAPYLRK+DL Y Y EL +L+ +F Sbjct: 90 YVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMF 123
>IAA26_ORYSA (Q652A1) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) Length = 140 Score = 47.8 bits (112), Expect = 8e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKVSMDG PYLRKVD+ YG Y EL AL+ +F Sbjct: 47 FVKVSMDGTPYLRKVDVAAYGDYLELVEALNDMF 80
>AX22E_PHAAU (O24543) Auxin-induced protein 22E (Indole-3-acetic acid-induced| protein ARG14) Length = 203 Score = 47.4 bits (111), Expect = 1e-05 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +Y+KVSM GAPYLRK+DL+ Y Y EL AL LF Sbjct: 108 MYLKVSMAGAPYLRKIDLKVYKSYPELLKALQNLF 142
>IAA15_ORYSA (Q6AT10) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 212 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKV++DGAPYLRKVDL Y GY +L AAL F Sbjct: 109 FVKVAVDGAPYLRKVDLEAYRGYDQLLAALQDKF 142
>IAA16_ORYSA (P0C127) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 228 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKV+MDG P RKVDL +GGY EL AA+D LF Sbjct: 99 FVKVNMDGVPIGRKVDLAAHGGYGELSAAVDRLF 132
>IAA7_ARATH (Q38825) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) (Auxin resistant 2) Length = 243 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 VKVSMDGAPYLRKVDL+ Y Y++L AL +F Sbjct: 127 VKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMF 159
>IAA1_ORYSA (Q5VRD1) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 199 Score = 45.8 bits (107), Expect = 3e-05 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKV++DGAPYLRKVDL Y GY +L AL F Sbjct: 95 FVKVAVDGAPYLRKVDLEAYSGYDQLLRALQDKF 128
>IAA5_ARATH (P33078) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) (Auxin-induced protein AUX2-27) Length = 163 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVS+DGA +LRK+DL Y Y++L +AL LF Sbjct: 76 YVKVSVDGAAFLRKIDLEMYKCYQDLASALQILF 109
>IAA11_ORYSA (Q75GK0) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 233 Score = 43.5 bits (101), Expect = 2e-04 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 VKVSMDGAPYLRK+D+ Y Y EL A +F Sbjct: 125 VKVSMDGAPYLRKIDVAMYKSYPELSMAFQNMF 157
>IAA23_ORYSA (Q69VE0) Auxin-responsive protein IAA23 (Indoleacetic acid-induced| protein 23) Length = 193 Score = 43.5 bits (101), Expect = 2e-04 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 VKV++DGAPYLRKVDL + GY L AL +F Sbjct: 86 VKVAVDGAPYLRKVDLAAHAGYAPLLRALHGMF 118
>IAA15_ARATH (Q9C966) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 179 Score = 42.0 bits (97), Expect = 5e-04 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV++DGA YLRKVDL Y Y +L AL+ +F Sbjct: 88 YVKVALDGAAYLRKVDLGMYDCYGQLFTALENMF 121
>IAA6_ARATH (Q38824) Auxin-responsive protein IAA6 (Indoleacetic acid-induced| protein 6) Length = 189 Score = 41.6 bits (96), Expect = 6e-04 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKVSMDG PY+RK+DL + Y L L+ LF Sbjct: 95 YVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLF 128
>IAA28_ARATH (Q9XFM0) Auxin-responsive protein IAA28 (Indoleacetic acid-induced| protein 28) Length = 175 Score = 41.2 bits (95), Expect = 8e-04 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 LYVK++M+G P RKV+L Y Y++L A+D LF Sbjct: 81 LYVKINMEGVPIGRKVNLSAYNNYQQLSHAVDQLF 115
>IAA26_ARATH (Q8LAL2) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) (Phytochrome-associated protein 1) Length = 269 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VK++MDG P RKVDL Y Y +L +D LF Sbjct: 152 MFVKINMDGVPIGRKVDLNAYNSYEQLSFVVDKLF 186
>IAA20_ARATH (O24410) Auxin-responsive protein IAA20 (Indoleacetic acid-induced| protein 20) Length = 175 Score = 40.8 bits (94), Expect = 0.001 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV+M+G P RK+DL + GYR+L LD +F Sbjct: 86 YVKVNMEGVPIGRKIDLMSLNGYRDLIRTLDFMF 119
>IAA18_ORYSA (Q5W670) Auxin-responsive protein IAA18 (Indoleacetic acid-induced| protein 18) Length = 327 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 VK++MDG P RKVDL+ Y Y++L +A++ LF Sbjct: 212 VKINMDGIPIGRKVDLQIYDSYQKLSSAVEELF 244
>IAA30_ARATH (Q9M1R4) Putative auxin-responsive protein IAA30 (Putative| indoleacetic acid-induced protein 30) Length = 172 Score = 38.9 bits (89), Expect = 0.004 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV+M+G P RK+DL + GY +L LD +F Sbjct: 84 YVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMF 117
>IAA7_ORYSA (Q6H543) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) Length = 300 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++K++MDG P RK+DL + Y +L A+D LF Sbjct: 179 FIKINMDGVPIGRKIDLNAFDSYEKLSLAVDKLF 212
>IAA29_ARATH (Q93WC4) Auxin-responsive protein IAA29 (Indoleacetic acid-induced| protein 29) Length = 251 Score = 35.4 bits (80), Expect = 0.042 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +YVKV MDG RKVD++ + Y L +L +F Sbjct: 160 MYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMF 194
>IAA6_ORYSA (Q8LQ74) Auxin-responsive protein IAA6 (Indoleacetic acid-induced| protein 6) Length = 335 Score = 35.4 bits (80), Expect = 0.042 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 VK++MDG P RK+DL Y Y L +A+ LF Sbjct: 220 VKINMDGIPIGRKIDLAAYNSYDGLSSAVKQLF 252
>IAA18_ARATH (O24408) Auxin-responsive protein IAA18 (Indoleacetic acid-induced| protein 18) Length = 267 Score = 35.0 bits (79), Expect = 0.055 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VK++M G P RKVDL + Y +L +D LF Sbjct: 150 MFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLF 184
>IAA12_ARATH (Q38830) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) (BODENLOS protein) Length = 239 Score = 34.7 bits (78), Expect = 0.072 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKV+MDG RKVD+R + Y L L+ +F Sbjct: 126 FVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMF 159
>IAA11_ARATH (Q38829) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 246 Score = 34.7 bits (78), Expect = 0.072 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VKV+MDG P RK+DL + Y L L+ +F Sbjct: 137 MFVKVTMDGIPIGRKIDLNAHKCYESLSNTLEEMF 171
>IAA8_ORYSA (Q6Z5M0) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 205 Score = 34.3 bits (77), Expect = 0.094 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 L+VKV M+G P RK+DL GY+ L A L ++F Sbjct: 104 LFVKVYMEGVPIGRKLDLLPLDGYKGLVARLASMF 138
>IAA31_ARATH (Q8H174) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 158 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 L+VKV M+G P RK+DL + GY L L +F Sbjct: 73 LFVKVYMEGVPIGRKLDLCVFSGYESLLENLSHMF 107
>IAA10_ORYSA (Q59AA1) Auxin-responsive protein IAA10 (Indoleacetic acid-induced| protein 10) Length = 281 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +VKV+MDG RKVDL + Y+ L AL+ +F Sbjct: 165 WVKVNMDGEVIGRKVDLNAHRSYKTLALALELMF 198
>IAA13_ARATH (Q38831) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 247 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++KV+MDG RKVDL + Y L L+ +F Sbjct: 131 FIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMF 164
>IAA20_ORYSA (Q5VRR0) Auxin-responsive protein IAA20 (Indoleacetic acid-induced| protein 20) Length = 183 Score = 32.0 bits (71), Expect = 0.47 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV M+G RK+DL G Y EL L +F Sbjct: 100 YVKVKMEGLAIGRKLDLSILGSYAELLDTLHLMF 133
>IAA10_ARATH (Q38828) Auxin-responsive protein IAA10 (Indoleacetic acid-induced| protein 10) Length = 261 Score = 32.0 bits (71), Expect = 0.47 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 + VKV+MDG RKVDL Y L LD +F Sbjct: 152 MLVKVTMDGVIIGRKVDLNALDSYAALEKTLDLMF 186
>IAA25_ORYSA (P0C128) Auxin-responsive protein IAA25 (Indoleacetic acid-induced| protein 25) Length = 246 Score = 31.6 bits (70), Expect = 0.61 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VKV+++G RK+DL+ + Y L AL ++F Sbjct: 144 MFVKVNLEGYAVGRKIDLKAHRSYDSLSQALQSMF 178
>IAA22_ORYSA (Q69TU6) Auxin-responsive protein IAA22 (Indoleacetic acid-induced| protein 22) Length = 265 Score = 31.6 bits (70), Expect = 0.61 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 ++VKV+++G RK+DL+ + Y L AL ++F Sbjct: 92 MFVKVNLEGYAVGRKIDLKAHRSYDSLSQALQSMF 126
>IAA9_ORYSA (Q6K846) Auxin-responsive protein IAA9 (Indoleacetic acid-induced| protein 9) Length = 182 Score = 31.2 bits (69), Expect = 0.80 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV +G RKVDL + Y EL A L +F Sbjct: 94 YVKVKKEGDAIGRKVDLALHSSYDELAATLARMF 127
>IAA4_ORYSA (Q59AF4) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) Length = 203 Score = 30.4 bits (67), Expect = 1.4 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 L+VKV M+G P RK+DL GY L L +F Sbjct: 109 LFVKVYMEGVPIGRKLDLLLLDGYDSLLIKLCHMF 143
>ARFI_ARATH (Q9XED8) Auxin response factor 9| Length = 638 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +2 Query: 77 KVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 KV M G P R VDL GY EL ++ LF Sbjct: 527 KVQMQGVPVGRAVDLNALKGYNELIDDIEKLF 558
>IAA34_ARATH (Q9C5X0) Auxin-responsive protein IAA34 (Indoleacetic acid-induced| protein 34) Length = 185 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV+MDG RKV + +G Y L L+ +F Sbjct: 94 YVKVTMDGLVVGRKVCVLDHGSYSTLAHQLEDMF 127
>IAA27_ORYSA (P0C129) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) Length = 143 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 68 LYVKVSMDGAPYLRKVDLRTYGGYRELRAAL 160 ++ KV MDG RK++LR + Y LR L Sbjct: 27 MFAKVHMDGYKVGRKINLRAHRNYDSLRRVL 57
>ARFM_ARATH (Q9FX25) Putative auxin response factor 13| Length = 623 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 74 VKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 +KV M G R VDL GY +L L+ LF Sbjct: 513 IKVHMQGVAISRAVDLTAMHGYNQLIQKLEELF 545
>IAA28_ORYSA (P0C130) Putative auxin-responsive protein IAA28 (Indoleacetic| acid-induced protein 28) Length = 162 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDAL 169 +VKV M G P+ RK++L + Y L L L Sbjct: 25 FVKVFMHGEPFERKINLAIHNNYDSLSFTLKRL 57
>IAA32_ARATH (Q8RYC6) Auxin-responsive protein IAA32 (Indoleacetic acid-induced| protein 32) Length = 191 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 71 YVKVSMDGAPYLRKVDLRTYGGYRELRAALDALF 172 YVKV++DG RKV L G Y L L+ +F Sbjct: 100 YVKVNLDGLVVGRKVCLVDQGAYATLALQLNDMF 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.306 0.142 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,519,823 Number of Sequences: 219361 Number of extensions: 96005 Number of successful extensions: 220 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.8 bits)
