ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd27a08 |
|---|---|
| Clone Library Name | barley_pub |
>YT64_CAEEL (Q11080) Hypothetical protein B0563.4 in chromosome X| Length = 276 Score = 37.0 bits (84), Expect = 0.022 Identities = 17/37 (45%), Positives = 27/37 (72%) Frame = +1 Query: 22 LXNLIKRHTYDEYIWASVELYLDILNLFLTILQMLRQ 132 L ++ R + ++YI A V LY+DILNLF+ ILQ++ + Sbjct: 237 LDMIMYRFSPEDYICACVSLYMDILNLFIRILQIVAE 273
>TMBI4_MOUSE (Q9DA39) Transmembrane BAX inhibitor motif-containing protein 4| (Z-protein) Length = 238 Score = 35.8 bits (81), Expect = 0.048 Identities = 15/33 (45%), Positives = 26/33 (78%) Frame = +1 Query: 28 NLIKRHTYDEYIWASVELYLDILNLFLTILQML 126 +L+ R + +EY+ A++ LY+DI+NLFL +L+ L Sbjct: 200 SLMHRLSPEEYVIAAISLYMDIINLFLHLLKFL 232
>TMBI4_HUMAN (Q9HC24) Transmembrane BAX inhibitor motif-containing protein 4| (Z-protein) (S1R protein) Length = 238 Score = 35.8 bits (81), Expect = 0.048 Identities = 15/33 (45%), Positives = 26/33 (78%) Frame = +1 Query: 28 NLIKRHTYDEYIWASVELYLDILNLFLTILQML 126 +L+ + + +EY+ A++ LYLDI+NLFL +L+ L Sbjct: 200 SLMHKLSPEEYVLAAISLYLDIINLFLHLLRFL 232
>Y920_HELPY (O25578) Hypothetical protein HP0920| Length = 230 Score = 35.0 bits (79), Expect = 0.082 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 7 YXSTTLXNLIKRHTYDEYIWASVELYLDILNLFLTILQML 126 Y + N++K YD I A+V LYLD LN+F++ILQ++ Sbjct: 184 YIAYDTQNIVKG-MYDSPIDAAVSLYLDFLNVFISILQII 222
>Y920_HELPJ (Q9ZKT1) Hypothetical protein jhp_0854| Length = 230 Score = 35.0 bits (79), Expect = 0.082 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 7 YXSTTLXNLIKRHTYDEYIWASVELYLDILNLFLTILQML 126 Y + N++K YD I A+V LYLD LN+F++ILQ++ Sbjct: 184 YIAYDTQNIVKG-MYDSPIDAAVSLYLDFLNVFISILQII 222
>YN45_YEAST (P48558) Hypothetical 33.6 kDa protein in MCK1-RPS19B intergenic| region Length = 297 Score = 33.9 bits (76), Expect = 0.18 Identities = 18/38 (47%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +1 Query: 31 LIKRHTY-DEYIWASVELYLDILNLFLTILQMLRQNDN 141 LI R Y DE + ++ LYLDI+NLFL+IL++L +++ Sbjct: 258 LIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSND 295
>BI1_PONPY (Q5R7R1) Bax inhibitor 1 (BI-1) (Testis-enhanced gene transcript)| Length = 237 Score = 32.0 bits (71), Expect = 0.70 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 43 HTYDEYIWASVELYLDILNLFLTILQMLRQND 138 H +YIW ++L+LD + LF ++ +L N+ Sbjct: 198 HGDQDYIWHCIDLFLDFITLFRKLMMILAMNE 229
>BI1_PAROL (Q9IA79) Probable Bax inhibitor 1 (BI-1)| Length = 237 Score = 32.0 bits (71), Expect = 0.70 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 55 EYIWASVELYLDILNLFLTILQMLRQND 138 +Y+W SV+L+LD + +F ++ +L ND Sbjct: 202 DYVWHSVDLFLDFITIFRKLMVILALND 229
>Y236_CAMJE (Q9PIQ8) Hypothetical protein Cj0236c| Length = 231 Score = 31.6 bits (70), Expect = 0.91 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +1 Query: 34 IKRHTYDEYIWASVELYLDILNLFLTILQMLR 129 I R Y+ I +V LYLD +NLF+++L +LR Sbjct: 195 IIRGNYETPIEGAVALYLDFVNLFVSLLNILR 226
>Y539_BORBU (O51489) Hypothetical protein BB0539| Length = 232 Score = 31.2 bits (69), Expect = 1.2 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 67 ASVELYLDILNLFLTILQMLRQNDN 141 AS++LYLD +NLFL +L+ L Q N Sbjct: 207 ASLKLYLDFINLFLYLLRFLGQRRN 231
>BI1_HUMAN (P55061) Bax inhibitor 1 (BI-1) (Testis-enhanced gene transcript)| (Transmembrane BAX inhibitor motif-containing protein 6) Length = 237 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 43 HTYDEYIWASVELYLDILNLFLTILQMLRQND 138 H +YIW ++L+LD + +F ++ +L N+ Sbjct: 198 HGDQDYIWHCIDLFLDFITVFRKLMMILAMNE 229
>Y1358_VIBCH (Q9KSA1) Hypothetical protein VC1358| Length = 223 Score = 30.4 bits (67), Expect = 2.0 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +1 Query: 34 IKRHTYDEYIWASVELYLDILNLF---LTILQMLRQND 138 I R YI A++ +YL+ILNLF L+IL ++ ND Sbjct: 186 IVRGEETNYISATISMYLNILNLFTSLLSILGIMNNND 223
>ETS6_DROME (P29776) DNA-binding protein D-ETS-6| Length = 475 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 60 HLGFC*TLPRHPQPVPHHPTDAQAERQLMSP 152 H G L RHP P+ HHP + QL P Sbjct: 363 HAGGAMQLGRHPPPLHHHPQHSHPHHQLGQP 393
>BI1_MOUSE (Q9D2C7) Bax inhibitor 1 (BI-1) (Testis-enhanced gene transcript)| Length = 237 Score = 29.6 bits (65), Expect = 3.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 43 HTYDEYIWASVELYLDILNLFLTILQMLRQND 138 H +YIW V+L+LD + LF ++ +L N+ Sbjct: 198 HGDKDYIWHCVDLFLDFVTLFRKLMLILAFNE 229
>FAIM2_MOUSE (Q8K097) Fas apoptotic inhibitory molecule 2 (Lifeguard protein)| Length = 317 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +1 Query: 37 KRHTY--DEYIWASVELYLDILNLFLTILQMLRQN 135 +RH+ +EYI+ ++ +YLDI+ +F LQ+ N Sbjct: 281 RRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTN 315
>FAIM2_RAT (O88407) Fas apoptotic inhibitory molecule 2 (Lifeguard protein)| (Neural membrane protein 35) Length = 316 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +1 Query: 37 KRHTY--DEYIWASVELYLDILNLFLTILQMLRQN 135 +RH+ +EYI+ ++ +YLDI+ +F LQ+ N Sbjct: 280 RRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTN 314
>FAIM2_HUMAN (Q9BWQ8) Fas apoptotic inhibitory molecule 2 (Lifeguard protein)| (Transmembrane BAX inhibitor motif-containing protein 2) Length = 316 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +1 Query: 37 KRHTY--DEYIWASVELYLDILNLFLTILQMLRQN 135 +RH+ +EYI+ ++ +YLDI+ +F LQ+ N Sbjct: 280 RRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTN 314
>GIDA_TREDE (Q73PH1) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 628 Score = 29.3 bits (64), Expect = 4.5 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -3 Query: 296 HIGCTLASSLDDGKNSLPCLPSYVDSNSKD 207 HIG +LA +L D + SL C+ + +D NSKD Sbjct: 514 HIGKSLADALHDPQVSLECICA-IDENSKD 542
>BI1_RAT (P55062) Bax inhibitor 1 (BI-1) (Testis-enhanced gene transcript)| Length = 237 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 43 HTYDEYIWASVELYLDILNLFLTILQMLRQND 138 H +YIW ++L+LD + LF ++ +L N+ Sbjct: 198 HGDKDYIWHCIDLFLDFVTLFRKLMLILAFNE 229
>Y408_STRP8 (Q8P2D4) Hypothetical membrane protein spyM18_0408| Length = 229 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = +1 Query: 64 WA---SVELYLDILNLFLTILQMLRQND 138 WA ++ LYLD +NLF+++L++ +ND Sbjct: 202 WAVAMALSLYLDFINLFISLLRIFGRND 229
>Y358_STRP1 (Q9A1B9) Hypothetical membrane protein SPy0358/M5005_Spy0301| Length = 229 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = +1 Query: 64 WA---SVELYLDILNLFLTILQMLRQND 138 WA ++ LYLD +NLF+++L++ +ND Sbjct: 202 WAVAMALSLYLDFINLFISLLRIFGRND 229
>Y327_STRP6 (Q5XDQ1) Hypothetical membrane protein M6_Spy0327| Length = 229 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = +1 Query: 64 WA---SVELYLDILNLFLTILQMLRQND 138 WA ++ LYLD +NLF+++L++ +ND Sbjct: 202 WAVAMALSLYLDFINLFISLLRIFGRND 229
>Y260_STRP3 (Q8K8I9) Hypothetical membrane protein SpyM3_0260/SPs1599| Length = 229 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = +1 Query: 64 WA---SVELYLDILNLFLTILQMLRQND 138 WA ++ LYLD +NLF+++L++ +ND Sbjct: 202 WAVAMALSLYLDFINLFISLLRIFGRND 229
>Y2604_PSEAE (Q03268) Hypothetical protein PA2604| Length = 222 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +1 Query: 58 YIWASVELYLDILNLFLTILQM 123 YI A++ LY+ I NLF+++LQ+ Sbjct: 193 YIMATISLYVSIYNLFISLLQI 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,085,306 Number of Sequences: 219361 Number of extensions: 1053658 Number of successful extensions: 2371 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2371 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
