ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd26f24 |
|---|---|
| Clone Library Name | barley_pub |
>SIX3_BUTSI (P82813) Insect toxin 3 (BsIT3) (Bs-dprIT3)| Length = 61 Score = 32.7 bits (73), Expect = 0.73 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -3 Query: 299 SLGKASCSSTSFCWTWRVECSLACWPEALLESWR 198 S+ K+S S +CWTW LACW E L S R Sbjct: 23 SMCKSSGGSYGYCWTW----GLACWCEGLPNSKR 52
>SIXC_MESMA (Q9Y1U3) Depressant insect neurotoxin BmK ITc precursor| Length = 85 Score = 32.3 bits (72), Expect = 0.95 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 290 KASCSSTSFCWTWRVECSLACWPEAL--LESWRERMSLLGTSR 168 K S S +CWTW LACW E L E W+ + G+ + Sbjct: 47 KKSGGSYGYCWTW----GLACWCEGLPDNEKWKYESNTCGSKK 85
>SIX5_BUTOC (P55904) Insect toxin 5 (BotIT5)| Length = 61 Score = 31.6 bits (70), Expect = 1.6 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 5/69 (7%) Frame = -3 Query: 368 YFLKRIG---SNGFFSLACAERCFSLSLGKASCSSTSFCWTWRVECSLACWPEALLE--S 204 Y KR G S F + C + C KA S +CWTW LACW E L + + Sbjct: 3 YIRKRDGCKVSCLFGNEGCDKEC------KAYGGSYGYCWTW----GLACWCEGLPDDKT 52 Query: 203 WRERMSLLG 177 W+ + G Sbjct: 53 WKSETNTCG 61
>EFG2_PSEPK (Q88FI4) Elongation factor G 2 (EF-G 2)| Length = 703 Score = 31.2 bits (69), Expect = 2.1 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 292 PKLNEKHLSAQANEKKPFDPMRFKKYTERARGVLNLA 402 P EKHL A++K+PF + FK T+ G L A Sbjct: 301 PDDEEKHLERHADDKEPFSALAFKIATDPFVGTLTFA 337
>SIX4_BUTSI (P82814) Insect toxin 4 (BsIT4) (Bs-dprIT4)| Length = 62 Score = 31.2 bits (69), Expect = 2.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 350 GSNGFFSLACAERCFSLSLGKASCSSTSFCWTWRVECSLACWPEAL 213 G+ G F S+ K+S S +CW+W LACW E L Sbjct: 6 GNKGCKVSCVINNVFCNSMCKSSGGSYGYCWSW----GLACWCEGL 47
>SIX4_BUTOC (P55903) Insect toxin 4 (BotIT4)| Length = 61 Score = 31.2 bits (69), Expect = 2.1 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 338 FFSLACAERCFSLSLGKASCSSTSFCWTWRVECSLACWPEALLE--SWRERMSLLG 177 F + C + C KA S +CWTW LACW E L + +W+ + G Sbjct: 16 FGNEGCDKEC------KAYGGSYGYCWTW----GLACWCEGLPDDKTWKSETNTCG 61
>SIX2_LEIQH (Q26292) Insect toxin 2 precursor (Lqh IT2) (LqhIT2) (LqhIT2-44)| Length = 85 Score = 31.2 bits (69), Expect = 2.1 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -3 Query: 353 IGSNGFFSLACAERCFSLSLGKASCSSTSFCWTWRVECSLACWPEALLE--SWRERMSLL 180 IG+ G C + C KA S +CWTW LACW E L + +W+ + Sbjct: 37 IGNEG-----CDKEC------KAYGGSYGYCWTW----GLACWCEGLPDDKTWKSETNTC 81 Query: 179 G 177 G Sbjct: 82 G 82
>SIX2_BUTAR (P80962) Depressant insect toxin 2 (BaIT2)| Length = 61 Score = 31.2 bits (69), Expect = 2.1 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 338 FFSLACAERCFSLSLGKASCSSTSFCWTWRVECSLACWPEALLE--SWRERMSLLG 177 F + C + C KA S +CWTW LACW E L + +W+ + G Sbjct: 16 FGNEGCDKEC------KAYGGSYGYCWTW----GLACWCEGLPDDKTWKSETNTCG 61
>AEP1_MESMA (P15228) Neurotoxin AEP precursor (Anti-epilepsy peptide) (BmK AEP)| Length = 85 Score = 31.2 bits (69), Expect = 2.1 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 10/68 (14%) Frame = -3 Query: 350 GSNGFFSLACAERCFSLSLGKASCS--------STSFCWTWRVECSLACWPEALLE--SW 201 GSNG C C LG C+ S +CWTW+ LACW + L + +W Sbjct: 27 GSNG-----CKVSCL---LGNEGCNKECRAYGASYGYCWTWK----LACWCQGLPDDKTW 74 Query: 200 RERMSLLG 177 + + G Sbjct: 75 KSESNTCG 82
>GOGB1_HUMAN (Q14789) Golgin subfamily B member 1 (Giantin) (Macrogolgin) (372 kDa| Golgi complex-associated protein) (GCP372) Length = 3259 Score = 30.8 bits (68), Expect = 2.8 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 205 LSSKASGQHASEHSTRQVQQKEVELHDALPKLNEKHLSAQANEKKPFDPMRFKK 366 L K Q E Q++QK+ +L L + EKHL + N ++ D +R +K Sbjct: 2099 LKLKKELQSNKESVKSQMKQKDEDLERRLEQAEEKHLKEKKNMQEKLDALRREK 2152
>SX25_LEIQH (P68726) Insect toxin 2-53 precursor (LqhIT2-53)| Length = 85 Score = 30.8 bits (68), Expect = 2.8 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 290 KASCSSTSFCWTWRVECSLACWPEALLE--SWRERMSLLG 177 KA S +CWTW LACW E L + +W+ + G Sbjct: 47 KAYGGSYGYCWTW----GLACWCEGLPDDKTWKSETNTCG 82
>SIX3_MESMA (Q17231) Insect toxin 3 precursor (Fragment)| Length = 64 Score = 30.8 bits (68), Expect = 2.8 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 7/68 (10%) Frame = -3 Query: 350 GSNGFFSLACAERCFSLSLG-----KASCSSTSFCWTWRVECSLACWPEALLE--SWRER 192 GSNG C C + G +A +S +CWTW LACW E L + +W+ Sbjct: 6 GSNG-----CKVSCLWGNEGCNKECRAYGASYGYCWTW----GLACWCEGLPDDKTWKSE 56 Query: 191 MSLLGTSR 168 + G + Sbjct: 57 SNTCGRKK 64
>SIX2_LEIQU (P19855) Depressant insect toxin 2 precursor (Insect toxin LqqIT2)| Length = 82 Score = 30.4 bits (67), Expect = 3.6 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 5/69 (7%) Frame = -3 Query: 368 YFLKRIG---SNGFFSLACAERCFSLSLGKASCSSTSFCWTWRVECSLACWPEALLE--S 204 Y KR G S F + C + C K+ S +CWTW LACW E L + + Sbjct: 24 YIRKRDGCKLSCLFGNEGCNKEC------KSYGGSYGYCWTW----GLACWCEGLPDDKT 73 Query: 203 WRERMSLLG 177 W+ + G Sbjct: 74 WKSETNTCG 82
>NOL1_HUMAN (P46087) Proliferating-cell nucleolar antigen p120| (Proliferation-associated nucleolar protein p120) Length = 855 Score = 30.0 bits (66), Expect = 4.7 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +1 Query: 157 EEGRLLVP-SRLMRSRQLSSKASGQHASEHSTR-QVQQKEVELHDALPKLNEKHLSAQAN 330 EEG L+P R R ++ A+G SE T + ++KEV PK+ E Q N Sbjct: 154 EEGEALLPIERAARKQKAREAAAGIQWSEEETEDEEEEKEVTPESGPPKVEEADGGLQIN 213 Query: 331 -EKKPF 345 +++PF Sbjct: 214 VDEEPF 219
>SH2P1_XENLA (Q4QR29) SH2 domain-binding protein 1| Length = 1157 Score = 30.0 bits (66), Expect = 4.7 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +1 Query: 211 SKASGQHASEHSTRQVQQKEVELHDALPKLNEKHLSAQANEKKPFDPMRFKKYTERARGV 390 ++ + E T+Q Q+KEV L + EKHL +KK + + +Y E+ R + Sbjct: 831 ARKQDEEEKEMRTKQEQEKEVLRQKLLKEQEEKHLREIEEQKKLLE--QRAQYLEKTRNL 888 Query: 391 LN 396 L+ Sbjct: 889 LS 890
>SIX2_MESMA (P68727) Depressant insect toxin BmK IT2| Length = 61 Score = 30.0 bits (66), Expect = 4.7 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 290 KASCSSTSFCWTWRVECSLACWPEALLE--SWRERMSLLG 177 +A +S +CWTW LACW E L + +W+ + G Sbjct: 26 RAYGASYGYCWTW----GLACWCEGLPDNKTWKSESNTCG 61
>SCN2_MESMA (Q9BKJ1) Anti-neuroexcitation peptide 2 precursor| (Anti-neuroexcitation peptide II) (ANEPII) Length = 85 Score = 30.0 bits (66), Expect = 4.7 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 290 KASCSSTSFCWTWRVECSLACWPEALLE--SWRERMSLLG 177 +A +S +CWTW LACW E L + +W+ + G Sbjct: 47 RAYGASYGYCWTW----GLACWCEGLPDDKTWKSESNTCG 82
>ACSA_SCHPO (P78773) Probable acetyl-coenzyme A synthetase (EC 6.2.1.1)| (Acetate--CoA ligase) (Acyl-activating enzyme) Length = 662 Score = 29.6 bits (65), Expect = 6.1 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 3/84 (3%) Frame = +1 Query: 226 QHASEHSTRQVQQKEVELHDALPKLNEKHLSAQANEKKPFDPMRFKKYTERARGVLNLAC 405 Q ++E + V+ ++V HD +PK A N + P + T + +GV++ C Sbjct: 229 QRSAEPTASMVEGRDVWWHDIIPKFPRYCPPAVVNPEHPLFLLYTSGSTGKPKGVVH--C 286 Query: 406 KATFFVYASA---FLFGITGADRM 468 + + A+A ++F + DRM Sbjct: 287 TGGYLLGAAATCKYVFDLHPTDRM 310
>SIXA1_MESMA (Q8T3T0) Depressant insect toxin BmK ITa1 precursor| Length = 85 Score = 29.6 bits (65), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -3 Query: 278 SSTSFCWTWRVECSLACWPEALLE--SWRERMSLLG 177 +S +CWTW LACW E L + +W+ + G Sbjct: 51 ASYGYCWTW----GLACWCEGLPDDKTWKSESNTCG 82
>PT122_SACKL (O13377) Protein PET122, mitochondrial precursor| Length = 312 Score = 29.3 bits (64), Expect = 8.0 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -3 Query: 416 NVALQ-AKFSTPRALSVYFLKRIGSNGFFSLACAE--RCFSLSLGKASCSSTSFCWTWRV 246 N+ALQ K P LS +F+K GSN + E R S K + TSF W+V Sbjct: 92 NIALQEGKLFIPEQLSSHFMKFYGSNNEYEQYRYELLRIQVESFAKGTMEKTSFREKWKV 151
>A36DE_DROME (Q9V3R1) Accessory gland protein Acp36DE precursor| Length = 912 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 190 MRSRQLSSKASGQHASEHSTRQVQQKEVEL 279 ++ ++L K++ Q SE TRQ QQK++ L Sbjct: 322 LQQKELDDKSASQSQSESKTRQEQQKQLNL 351
>ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2948 Score = 29.3 bits (64), Expect = 8.0 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -3 Query: 344 NGFFSLACAERCFSLSLGKASCSSTSFCWTWRVEC-SLACWPEALLESWRERMSLLGTSR 168 NGF ++ + S SL ++ SF W W++ C + C EA E +L Sbjct: 2004 NGFLGVS---KLVSKSLNNVDTNNASFEWAWKLNCWDIPCPREANEEHQLIYKTLKQIHD 2060 Query: 167 RPSSATAAC 141 PS A+ +C Sbjct: 2061 YPSFASESC 2069
>US20_HCMVT (Q03307) Transmembrane protein HWLF3| Length = 342 Score = 29.3 bits (64), Expect = 8.0 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = -3 Query: 302 LSLGKASCSSTSFCWTWRVECSLACWPEALLESWRERMSLLGTSRRPSSATAACVRWSRA 123 +S +++C+ TS T CS +C P + R SL RRPSS+ VR Sbjct: 4 ISRARSACTWTSC--TSLSPCSTSCPPSPAAPTLLRRRSLPQQRRRPSSSPNRRVRGVTT 61 Query: 122 PP----SLLAKHRTAA 87 P SL+ K R A Sbjct: 62 SPCPTRSLVYKRRVGA 77
>US20_HCMVA (P09724) Transmembrane protein HWLF3| Length = 342 Score = 29.3 bits (64), Expect = 8.0 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = -3 Query: 302 LSLGKASCSSTSFCWTWRVECSLACWPEALLESWRERMSLLGTSRRPSSATAACVRWSRA 123 +S +++C+ TS T CS +C P + R SL RRPSS+ VR Sbjct: 4 ISRARSACTWTSC--TSLSPCSTSCPPSPAAPTLLRRRSLPQQRRRPSSSPNRRVRGVTT 61 Query: 122 PP----SLLAKHRTAA 87 P SL+ K R A Sbjct: 62 SPCPTRSLVYKRRVGA 77
>SIXA_MESMA (Q9XY87) Depressant insect neurotoxin BmK ITa precursor (BmK| dITAP3) Length = 85 Score = 29.3 bits (64), Expect = 8.0 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 7/65 (10%) Frame = -3 Query: 350 GSNGFFSLACAERCFSLSLG-----KASCSSTSFCWTWRVECSLACWPEALLE--SWRER 192 GSNG C C + G +A +S +CWTW LACW + L + +W+ Sbjct: 27 GSNG-----CKVSCLWGNEGCNKECRAYGASYGYCWTW----GLACWCQGLPDDKTWKSE 77 Query: 191 MSLLG 177 + G Sbjct: 78 SNTCG 82
>AEP2_MESMA (Q86M31) Neurotoxin AEP2 precursor| Length = 85 Score = 29.3 bits (64), Expect = 8.0 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 7/65 (10%) Frame = -3 Query: 350 GSNGFFSLACAERCFSLSLG-----KASCSSTSFCWTWRVECSLACWPEALLE--SWRER 192 GSNG C C + G KA + +CWTW LACW E L + +W+ Sbjct: 27 GSNG-----CKVSCLWGNEGCNKECKAFGAYYGYCWTW----GLACWCEGLPDDKTWKSE 77 Query: 191 MSLLG 177 + G Sbjct: 78 SNTCG 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,326,062 Number of Sequences: 219361 Number of extensions: 1287434 Number of successful extensions: 3841 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3839 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
