| Clone Name | basd26e15 |
|---|---|
| Clone Library Name | barley_pub |
>PSB3_ORYSA (Q9LST7) Proteasome subunit beta type 3 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit beta-3) Length = 204 Score = 46.2 bits (108), Expect = 6e-05 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +2 Query: 194 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 283 S RRLGV L+T++ DF+R FKIHDKL+IGL Sbjct: 24 SDRRLGVQLQTVATDFQRVFKIHDKLYIGL 53
>PSB3_PICMA (O65084) Proteasome subunit beta type 3 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit beta-3) Length = 204 Score = 45.8 bits (107), Expect = 8e-05 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +2 Query: 194 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 283 S RRLGV L+T++ DF+R FKIHDKL++GL Sbjct: 24 SDRRLGVQLQTIATDFQRIFKIHDKLYVGL 53
>PSB3B_ARATH (O81153) Proteasome subunit beta type 3-B (EC 3.4.25.1) (20S| proteasome beta subunit C-2) Length = 204 Score = 39.7 bits (91), Expect = 0.006 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 194 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 283 S RRLGV L+T++ DF+R KIHD L IGL Sbjct: 24 SDRRLGVQLQTIATDFQRISKIHDHLFIGL 53
>PSB3A_ARATH (Q9XI05) Proteasome subunit beta type 3-A (EC 3.4.25.1) (20S| proteasome beta subunit C-1) (Proteasome component T) Length = 204 Score = 39.7 bits (91), Expect = 0.006 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = +2 Query: 194 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 283 S RRLGV L+T++ DF+R KIHD++ IGL Sbjct: 24 SDRRLGVQLQTIATDFQRISKIHDRVFIGL 53
>PQQF_PSEFL (P55174) Coenzyme PQQ synthesis protein F (EC 3.4.99.-)| (Pyrroloquinoline quinone biosynthesis protein F) Length = 829 Score = 30.0 bits (66), Expect = 4.6 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +3 Query: 102 TAPRLRSLLPHVQACSPRLRS*L---PHLKACSTRLAVSAYSY 221 + PR +L PH + C RLR L PHLK C+ L V+A S+ Sbjct: 10 SCPRRITLCPHWRPCQ-RLRVSLRHAPHLKRCAATLRVAAGSH 51
>ARHG6_CHICK (Q5ZLR6) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 764 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = -2 Query: 267 LSWILKALSKSTERVRSYTPRRRGEWSKPSDEEVKI 160 +S+ILK SKS + ++ + P+R+ E K SDEE I Sbjct: 600 MSYILKDSSKSPKTMKKFLPKRKTE-RKASDEEFVI 634
>ANC1_CAEEL (Q9N4M4) Nuclear anchorage protein 1 (Anchorage 1 protein) (Nesprin| homolog) Length = 8545 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 330 LCVDTQITSGEELLCHHGRSRKKIYHAVSIPGPLT 434 LC ++ +GE L H GR K+++H ++ LT Sbjct: 59 LCHLIEVLTGEALAVHKGRVSKRVHHIANLTTALT 93
>PSB3_ONCMY (O73817) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome| theta chain) (Proteasome chain 13) (Proteasome component C10-II) Length = 205 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 200 RRLGV*LRTLSVDFERAFKIHDKLHIGL 283 RR GV + ++ DF++ F + D+L+IGL Sbjct: 26 RRFGVQAQMVTTDFQKIFPMGDRLYIGL 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,914,161 Number of Sequences: 219361 Number of extensions: 1381795 Number of successful extensions: 3994 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3992 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)