| Clone Name | basd25i09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YQBQ_BACSU (P45950) Hypothetical protein yqbQ | 30 | 4.7 | 2 | PTDSR_HYDAT (Q6Q4H1) Protein PSR (Phosphatidylserine receptor) | 30 | 6.1 |
|---|
>YQBQ_BACSU (P45950) Hypothetical protein yqbQ| Length = 326 Score = 30.4 bits (67), Expect = 4.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 295 LSDTMTQSKYDRQQTNKCYRSLDGDMEGISSLG 393 ++DT T+ K RQ+ NK Y + D GIS G Sbjct: 197 INDTATKVKLRRQKDNKTYTATASDSSGISKYG 229
>PTDSR_HYDAT (Q6Q4H1) Protein PSR (Phosphatidylserine receptor)| Length = 385 Score = 30.0 bits (66), Expect = 6.1 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +1 Query: 283 VDDRLSDTMTQSKYDRQQTNKCYRSLDGDMEGISSLGNDNRFSIPMAHAMMTLPDDHC 456 +D R D + ++K K L GD EG + LG N F + H TLP HC Sbjct: 1 MDKRTDDAVRETKL------KARPELKGD-EGWTRLGYANNFDLSYQHIKDTLPRIHC 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,175,940 Number of Sequences: 219361 Number of extensions: 1409579 Number of successful extensions: 4208 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4208 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)