| Clone Name | basd25e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FOXF2_HUMAN (Q12947) Forkhead box protein F2 (Forkhead-related p... | 33 | 0.51 | 2 | SPY_ARATH (Q96301) Probable UDP-N-acetylglucosamine--peptide N-a... | 32 | 1.1 | 3 | OR1I1_HUMAN (O60431) Olfactory receptor 1I1 (Olfactory receptor ... | 30 | 4.3 | 4 | Y3226_LACPL (Q88SY9) Hypothetical RNA methyltransferase lp_3226 ... | 30 | 7.3 | 5 | PER_PERAM (Q25637) Period circadian protein | 29 | 9.6 |
|---|
>FOXF2_HUMAN (Q12947) Forkhead box protein F2 (Forkhead-related protein FKHL6)| (Forkhead-related transcription factor 2) (FREAC-2) (Forkhead-related activator 2) Length = 444 Score = 33.5 bits (75), Expect = 0.51 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 302 LWRCCSPVPGALLGS--SSAPAMGGTSLGCSLTTVETSSLSPTICLSRLTKS 153 L R CSPVPGAL + S PA + TT +SS S C S + S Sbjct: 12 LRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSS 63
>SPY_ARATH (Q96301) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SPINDLY (EC 2.4.1.-) Length = 914 Score = 32.3 bits (72), Expect = 1.1 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = -1 Query: 240 GWHFLRLQPHYCRNQQLVTDNLS*PSHKIGPAYLSPLEFFIVSMDY 103 GW F RL P Y DNL P I Y+SP +FF S+ Y Sbjct: 460 GWRFTRLHPQYTS-----WDNLKDPERPITIGYISP-DFFTHSVSY 499
>OR1I1_HUMAN (O60431) Olfactory receptor 1I1 (Olfactory receptor 19-20)| (OR19-20) Length = 355 Score = 30.4 bits (67), Expect = 4.3 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = -2 Query: 383 LYNLMDVLVLSVSIGADPRAVISTNCYLWRCCSPVPGALLGSS----SAPAMGGTSLGCS 216 L+ MD +L+V A++ YL CSPV G LLG+S + ++ T L Sbjct: 106 LFGTMDSFLLAVMAIDRFVAIVHPQRYLVLMCSPVCGLLLGASWMITNLQSLIHTCLMAQ 165 Query: 215 LTTVETSSLSPTIC 174 LT S +S C Sbjct: 166 LTFCAGSEISHFFC 179
>Y3226_LACPL (Q88SY9) Hypothetical RNA methyltransferase lp_3226 (EC 2.1.1.-)| Length = 481 Score = 29.6 bits (65), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 46 AYQGEVGGFELEH 8 AY GEVGGFELEH Sbjct: 101 AYAGEVGGFELEH 113
>PER_PERAM (Q25637) Period circadian protein| Length = 893 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 296 RCCSPVPGALLGSSSAPAMGGTSLGCSLTTVETSSLSPT 180 +CCSPV G+ GS S + G +G S + +S + T Sbjct: 669 KCCSPVNGSGSGSGSGHSSGSAGIGGSAESRRDTSATNT 707 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,239,523 Number of Sequences: 219361 Number of extensions: 1889829 Number of successful extensions: 4578 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4576 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)