ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd24o23 |
|---|---|
| Clone Library Name | barley_pub |
>VGLH_EHV4 (P24430) Glycoprotein H precursor| Length = 855 Score = 30.8 bits (68), Expect = 2.1 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 156 RIWHESYTGQENDGTSEPTFGKSKGYGRNGRFAYDF 49 R++ + TG E+DGT+ ++G+S N R AY+F Sbjct: 615 RLYTDLNTGLEDDGTTIHSYGRSANGILNSRIAYNF 650
>VGLH_EHV1B (Q6DLH1) Glycoprotein H precursor| Length = 848 Score = 30.4 bits (67), Expect = 2.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 156 RIWHESYTGQENDGTSEPTFGKSKGYGRNGRFAYDF 49 R++ + TG E+DGT+ ++G+S N R AY+F Sbjct: 608 RLYTDLNTGFEDDGTTIHSYGRSANGILNSRIAYNF 643
>VGLH_EHV1 (P68330) Glycoprotein H precursor| Length = 848 Score = 30.4 bits (67), Expect = 2.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 156 RIWHESYTGQENDGTSEPTFGKSKGYGRNGRFAYDF 49 R++ + TG E+DGT+ ++G+S N R AY+F Sbjct: 608 RLYTDLNTGFEDDGTTIHSYGRSANGILNSRIAYNF 643
>ERR3_PONPY (Q5RAM2) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) Length = 435 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 139 YSCPATNECEITKRRRKSCQACR 161
>ERR1_MOUSE (O08580) Steroid hormone receptor ERR1 (Estrogen-related receptor,| alpha) (ERR-alpha) (Estrogen receptor-like 1) (Fragment) Length = 462 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 153 YSCPASNECEITKRRRKACQACR 175
>ERR3_RAT (P62510) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) Length = 458 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 162 YSCPATNECEITKRRRKSCQACR 184
>ERR3_MOUSE (P62509) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) Length = 458 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 162 YSCPATNECEITKRRRKSCQACR 184
>ERR3_HUMAN (P62508) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) (ERR gamma-2) Length = 458 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 162 YSCPATNECEITKRRRKSCQACR 184
>ERR2_RAT (P11475) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) Length = 433 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 137 YSCPATNECEITKRRRKSCQACR 159
>ERR2_HUMAN (O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) Length = 500 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 137 YSCPATNECEITKRRRKSCQACR 159
>ERR1_HUMAN (P11474) Steroid hormone receptor ERR1 (Estrogen-related receptor,| alpha) (ERR-alpha) (Estrogen receptor-like 1) Length = 519 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 122 FSCPVYDSCQILIRRSNGCSGCR 190 +SCP + C+I RR C CR Sbjct: 210 YSCPASNECEITKRRRKACQACR 232
>TNC6B_HUMAN (Q9UPQ9) Trinucleotide repeat-containing 6B protein| Length = 1723 Score = 29.3 bits (64), Expect = 6.1 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = -3 Query: 221 PDRVRTRYVLFCNPNSRSTDGSEFGMSRTRDRRTTGHPSQRLGKARVTGETG 66 P T + +PN G FGM R+T PSQ G R TG G Sbjct: 373 PKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGD-RKTGSVG 423
>S28A1_PIG (O62667) Sodium/nucleoside cotransporter 1 (Na(+)/nucleoside| cotransporter 1) (Sodium-coupled nucleoside transporter 1) (Concentrative nucleoside transporter 1) (CNT 1) Length = 647 Score = 29.3 bits (64), Expect = 6.1 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 28 EIGGFAYEIICKPPVSPVTLAFPKRWLGCPVVL-LSRVRLMPNSDPSVERLFGLQK 192 ++ G ++++IC + PV W CPVV L ++L N + + L G ++ Sbjct: 453 DVQGLSFQLICSYVLRPVAFLMGVAWEDCPVVAELLGMKLFLNEFVAYQELSGYKQ 508
>DERM_BIOGL (P83553) Dermatopontin (Tyrosine-rich acidic matrix protein)| (TRAMP) Length = 148 Score = 29.3 bits (64), Expect = 6.1 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +1 Query: 241 RCPVGPVYESCQ----ILIRRPKGRSGCRKVRIVSHTVSLTGYRAALSLPVPCTCPVK 402 +CP G V +L+ + GCR V+ T S +GY LP+ +CP K Sbjct: 13 QCPAGQVISRVSSVYDVLLEDRQWEFGCRTEN-VTQTCSTSGYANDFGLPLSYSCPGK 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,822,470 Number of Sequences: 219361 Number of extensions: 1941278 Number of successful extensions: 5350 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 5136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5348 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
