ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd25d06 |
|---|---|
| Clone Library Name | barley_pub |
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 43.1 bits (100), Expect = 2e-04 Identities = 25/61 (40%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +1 Query: 118 KCCNNCR-SFSGVXVCDDAHPQCPKGXSXCRV---VTPSPHKTFRCADMXSTVDGTCGGP 285 KCC NC SFSG+ CDD C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 286 C 288 C Sbjct: 102 C 102
>ARHG6_HUMAN (Q15052) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) (PAK-interacting exchange factor alpha) (Alpha-Pix) (COOL-2) Length = 776 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 365 CSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 255 CS+H SF G PR L KP S C PP PS L Sbjct: 564 CSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606
>ARHG6_MOUSE (Q8K4I3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 771 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 365 CSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 255 CS+H SF G PR L KP S C PP PS L Sbjct: 563 CSTHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 605
>ARHG6_RAT (Q5XXR3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 772 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 365 CSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 255 CS+H SF G PR L KP S C PP PS L Sbjct: 564 CSTHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606
>POMT1_DROME (Q9VTK2) Protein O-mannosyltransferase 1 (EC 2.4.1.109)| (Dolichyl-phosphate-mannose--protein mannosyltransferase 1) (dPOMT1) (Protein rotated abdomen) Length = 886 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 115 PKCCNNCRSFSGVXVCDD--AHPQCPKGXSXCRVVTPSPHKT 234 P CCN R+ + + C D H P S R TP+P T Sbjct: 61 PLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPTPT 102
>RSPO1_HUMAN (Q2MKA7) R-spondin-1 precursor (Roof plate-specific spondin-1)| (hRspo1) Length = 263 Score = 28.1 bits (61), Expect = 5.3 Identities = 22/82 (26%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = +1 Query: 88 LSHVNADFFPKCCNNCRSFSGVXVCDD-AHPQCPKGXSXCRVVTPSPHKTFRCADMXSTV 264 + H A F C C+ G+ + +P CP+G S + T C+ Sbjct: 99 IEHCEACFSHNFCTKCKE--GLYLHKGRCYPACPEGSSAA-------NGTMECSSPAQCE 149 Query: 265 --DGTCGGPCKKH*SLXGFRLG 324 + + GPC K L GFR G Sbjct: 150 MSEWSPWGPCSKKQQLCGFRRG 171
>GBB_SOLTU (P93563) Guanine nucleotide-binding protein beta subunit| Length = 377 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 185 GHWGWASSQTXTPEKDLQLLQHLGKKSALTWERIPMTRTA 66 GH G+ SS P++D L+ G ++ + W+ RT+ Sbjct: 154 GHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTS 193
>GBB_NICPL (P93339) Guanine nucleotide-binding protein beta subunit (NpGPB1)| Length = 377 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 185 GHWGWASSQTXTPEKDLQLLQHLGKKSALTWERIPMTRTA 66 GH G+ SS P++D L+ G ++ + W+ RT+ Sbjct: 154 GHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTS 193
>GBB3_TOBAC (Q40507) Guanine nucleotide-binding protein beta subunit| Length = 375 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 185 GHWGWASSQTXTPEKDLQLLQHLGKKSALTWERIPMTRTA 66 GH G+ SS P++D L+ G ++ + W+ RT+ Sbjct: 154 GHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTS 193
>GBB1_TOBAC (P93397) Guanine nucleotide-binding protein beta subunit 1| Length = 377 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 185 GHWGWASSQTXTPEKDLQLLQHLGKKSALTWERIPMTRTA 66 GH G+ SS P++D L+ G ++ + W+ RT+ Sbjct: 154 GHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTS 193
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 275 QVPSTVLFMSAQRNVL*GL--GVTTRQXXQPLGHWGWASSQTXT 150 Q+P T +FMSA N L TT P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>CRVP2_NAJAT (Q7ZZN8) Natrin-2 precursor (Cysteine-rich venom protein 2)| (NA-CRVP2) (Protein G2b) Length = 238 Score = 27.7 bits (60), Expect = 6.9 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +1 Query: 133 CRSFSGVXVCDDAHPQCPKGXSXCRVVTPSPHKTFRCADMXST-VDGTCGGPCKKH 297 C S + VC CP G + TP C D S V+G C PCK H Sbjct: 153 CSSSKYLYVCQ----YCPTGNIIGSIATPYKSGP-PCGDCPSACVNGLCTNPCKHH 203
>TR11B_HUMAN (O00300) Tumor necrosis factor receptor superfamily member 11B| precursor (Osteoprotegerin) (Osteoclastogenesis inhibitory factor) Length = 401 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +1 Query: 172 HPQCPKGXSXCRVVTPSPHKTF-RCADMXSTVDGTCGGPCKKH*SLXGFRL 321 H CP G + TP + RC D + + + PC+KH + F L Sbjct: 121 HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGL 171
>RSPO1_MOUSE (Q9Z132) R-spondin-1 precursor (Roof plate-specific spondin-1)| (Cysteine-rich and single thrombospondin domain-containing protein 3) (Cristin-3) (mCristin-3) Length = 265 Score = 27.3 bits (59), Expect = 9.0 Identities = 20/77 (25%), Positives = 28/77 (36%), Gaps = 10/77 (12%) Frame = +1 Query: 124 CNNCRSFSGVXVCDDA--------HPQCPKGXSXCRVVTPSPHKTFRCADMXSTV--DGT 273 C C S + C +A +P CP+G + + T C + + Sbjct: 102 CEACFSHNFCTKCQEALYLHKGRCYPACPEGSTAA-------NSTMECGSPAQCEMSEWS 154 Query: 274 CGGPCKKH*SLXGFRLG 324 GPC K L GFR G Sbjct: 155 PWGPCSKKRKLCGFRKG 171
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 121 CCNNCRSFSGVXVCDDAHPQCPKG-XSXCRVVTPSPHKTFRCADMXSTVDGTCGG 282 CC C + P CP G S C TFRC + +GT G Sbjct: 5418 CCPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQLCSYNGTFYG 5472
>GNRR2_CLAGA (O42329) Gonadotropin-releasing hormone II receptor (Type II GnRH| receptor) (GnRH-II-R) Length = 379 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 101 LTWERIPMTRTAWRIRIAASLVLFM--AAXELS 9 L WE P TA R R+AA+LVLF+ AA LS Sbjct: 31 LKWET-PTFTTAARFRVAATLVLFVFAAASNLS 62
>AT131_MOUSE (Q9EPE9) Probable cation-transporting ATPase 13A1 (EC 3.6.3.-)| (CATP) Length = 1200 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 185 GHWGWASSQTXTPEKDLQLLQHLGKKSALT 96 G WGW SS T PE L L + ALT Sbjct: 82 GCWGWGSSWTQIPEAALLALATICLAHALT 111 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,569,224 Number of Sequences: 219361 Number of extensions: 548832 Number of successful extensions: 1333 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1330 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
