| Clone Name | basd24m17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OSH7_YEAST (P38755) Oxysterol-binding protein homolog 7 | 31 | 3.1 | 2 | CHSC_ASPFU (Q92197) Chitin synthase C (EC 2.4.1.16) (Chitin-UDP ... | 29 | 9.1 |
|---|
>OSH7_YEAST (P38755) Oxysterol-binding protein homolog 7| Length = 437 Score = 30.8 bits (68), Expect = 3.1 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 418 GFEVYTYTQGAFEIDKLDMVQRWTGDHKLPDQLLKLHDNHKDGIR 552 G ++ T F ++K M++R T + PD LL+ H N KDG++ Sbjct: 61 GCDLSRITLPTFILEKKSMLERITNQLQFPDVLLEAHSN-KDGLQ 104
>CHSC_ASPFU (Q92197) Chitin synthase C (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase C) (Class-III chitin synthase C) Length = 893 Score = 29.3 bits (64), Expect = 9.1 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 299 VHSN*IYSPRMKQVRGFRLHLHIFVNTCQLGMVW 400 +H IY VR F LH+ + N CQL M W Sbjct: 535 MHFGRIYKSGHSFVRMFFLHIQMIYNCCQLIMTW 568 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,700,273 Number of Sequences: 219361 Number of extensions: 1844812 Number of successful extensions: 5006 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5005 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)