ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd24m13 |
|---|---|
| Clone Library Name | barley_pub |
>TF2AA_RAT (O08949) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFIIA p19 subunit)] Length = 377 Score = 36.2 bits (82), Expect = 0.051 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 6 DVVAKFVRXFITYGVGDAVLNELQALWEMKMLHCGAISGXHRPQQ 140 DV+ F+ GV + VL EL+ LWE K++ A+ G H +Q Sbjct: 20 DVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQ 64
>TF2AA_MOUSE (Q99PM3) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFIIA p19 subunit)] Length = 378 Score = 36.2 bits (82), Expect = 0.051 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 6 DVVAKFVRXFITYGVGDAVLNELQALWEMKMLHCGAISGXHRPQQ 140 DV+ F+ GV + VL EL+ LWE K++ A+ G H +Q Sbjct: 20 DVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQ 64
>TF2AA_PONPY (Q5RCU0) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFIIA p19 subunit)] Length = 376 Score = 36.2 bits (82), Expect = 0.051 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 6 DVVAKFVRXFITYGVGDAVLNELQALWEMKMLHCGAISGXHRPQQ 140 DV+ F+ GV + VL EL+ LWE K++ A+ G H +Q Sbjct: 20 DVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQ 64
>TF2AA_HUMAN (P52655) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) (TFIIA-42) (TFIIAL) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFI Length = 376 Score = 36.2 bits (82), Expect = 0.051 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 6 DVVAKFVRXFITYGVGDAVLNELQALWEMKMLHCGAISGXHRPQQ 140 DV+ F+ GV + VL EL+ LWE K++ A+ G H +Q Sbjct: 20 DVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQ 64
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 33.5 bits (75), Expect = 0.33 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 341 GPSDYAPSPISDMRNGMGMNGSDPK-TGRPSPYMQPPSPWMNQRP 472 GP + P P+ + G G + G P P+MQPP P MNQ P Sbjct: 393 GPHSF-PHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGP 436
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 33.5 bits (75), Expect = 0.33 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 341 GPSDYAPSPISDMRNGMGMNGSDPK-TGRPSPYMQPPSPWMNQRP 472 GP + P P+ + G G + G P P+MQPP P MNQ P Sbjct: 393 GPHSF-PHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGP 436
>FUBP2_HUMAN (Q92945) Far upstream element-binding protein 2 (FUSE-binding| protein 2) (KH type splicing regulatory protein) (KSRP) (p75) Length = 707 Score = 33.1 bits (74), Expect = 0.44 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +2 Query: 335 PTGPSDYAPSPISDMRN------GMGMNGSDPKTGRPSPYMQPPSPWMNQRP 472 P GP P P M G G+ P G P P+ PP W N P Sbjct: 499 PVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYP 550
>FUBP2_RAT (Q99PF5) Far upstream element-binding protein 2 (FUSE-binding| protein 2) (KH type splicing regulatory protein) (KSRP) (MAP2 RNA trans-acting protein 1) (MARTA1) Length = 721 Score = 33.1 bits (74), Expect = 0.44 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +2 Query: 335 PTGPSDYAPSPISDMRN------GMGMNGSDPKTGRPSPYMQPPSPWMNQRP 472 P GP P P M G G+ P G P P+ PP W N P Sbjct: 502 PVGPGPGGPGPAGPMGPFHPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYP 553
>CSD_THEMA (Q9X191) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 413 Score = 31.2 bits (69), Expect = 1.7 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 418 SFWIRPIHPHPVSHVTDGRWGIVRRPCGYVIHPCIN 311 SF ++ IHPH V+H+ D +GI R + P ++ Sbjct: 334 SFNVKGIHPHDVAHILDQEFGIAVRSGHHCAQPLMS 369
>BCL9_HUMAN (O00512) B-cell lymphoma 9 protein (Bcl-9) (Legless homolog)| Length = 1426 Score = 29.3 bits (64), Expect = 6.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 359 PSPISDMRNGMGMNGSDPKTGRPSPYMQPPSPWMNQRPLGV 481 P P + + + GS P + +PY PP P ++Q PL + Sbjct: 971 PPPTASQPASVNIPGSLPSS---TPYTMPPEPTLSQNPLSI 1008
>BCL9_MOUSE (Q9D219) B-cell lymphoma 9 protein (Bcl-9)| Length = 1425 Score = 28.9 bits (63), Expect = 8.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 359 PSPISDMRNGMGMNGSDPKTGRPSPYMQPPSPWMNQRPLGV 481 P P + + + GS P + +PY PP P ++Q PL + Sbjct: 970 PPPTASQPASVNIPGSLPSS---TPYPMPPEPTLSQNPLSI 1007 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,939,546 Number of Sequences: 219361 Number of extensions: 1485266 Number of successful extensions: 4707 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4694 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
