| Clone Name | basd24l16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TALA_DICDI (P54633) Filopodin (Talin homolog) | 28 | 4.3 | 2 | NCKX2_RAT (O54701) Sodium/potassium/calcium exchanger 2 precurso... | 27 | 9.5 | 3 | ATG7_SCHPO (O43069) Autophagy-related protein 7 (Autophagy-relat... | 27 | 9.5 |
|---|
>TALA_DICDI (P54633) Filopodin (Talin homolog)| Length = 2492 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -3 Query: 317 HVPAVSCNNHIILPFESITTKSS*LTATR*SCEEAYKYSVTIHAKHGPILGLVKKEETQ 141 H + N I+LP +SI S LTA + ++ TI A +LG+ ++ +Q Sbjct: 1403 HCSISTYNPDILLPAKSILDASQMLTANQADVNHVLSHAATIAACTQQLLGITRERASQ 1461
>NCKX2_RAT (O54701) Sodium/potassium/calcium exchanger 2 precursor| (Na(+)/K(+)/Ca(2+)-exchange protein 2) (Retinal cone Na-Ca+K exchanger) Length = 670 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/54 (25%), Positives = 30/54 (55%) Frame = -1 Query: 325 LHHMCLLFLATTISSYHSKALQRNHHSSRQQDKVVRRLTNIL*LYTQNTVPYLV 164 LH + L S+ S + R H+++R++ K++R + ++ L +TVP+ + Sbjct: 3 LHQSATVRLLQEWCSHESPSGCRRHYNTRKKLKLIRVIGLVMGLVAVSTVPFSI 56
>ATG7_SCHPO (O43069) Autophagy-related protein 7 (Autophagy-related| E1-like-activating enzyme atg7) Length = 649 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +1 Query: 151 SFLTKPSMGPCFACIVTEYL*ASSQLYLVAVSYDDFVVMLSNGKMIWLLQETAGTCD 321 S + P C CI+ E+ L A++ D+V L + + L E AGT + Sbjct: 582 SGMAYPQCSACSECIINEWNREKWMFVLRAINEPDYVEELCGLREVQALGEIAGTME 638 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,017,386 Number of Sequences: 219361 Number of extensions: 642703 Number of successful extensions: 1633 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1632 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)