ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd25a15 |
|---|---|
| Clone Library Name | barley_pub |
>COVA1_MOUSE (Q8R0Z2) Tumor-associated hydroquinone oxidase (tNOX) (Cytosolic| ovarian carcinoma antigen 1) (APK1 antigen) [Includes: Hydroquinone [NADH] oxidase (EC 1.-.-.-); Protein disulfide-thiol oxidoreductase (EC 1.-.-.-)] Length = 598 Score = 29.6 bits (65), Expect = 4.0 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +2 Query: 368 NGNLPPGFD---PSTCRSVYVGNVHPNVTENLLIE 463 N NLPP P C++V+VG + N TE +++E Sbjct: 83 NPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVE 117
>ZIMP7_HUMAN (Q8NF64) PIAS-like protein Zimp7| Length = 920 Score = 29.6 bits (65), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 136 GSRGPSVPRCLDPVGVGG 189 G RGPSVP ++P G+GG Sbjct: 200 GPRGPSVPAGMNPTGIGG 217
>COVA1_HUMAN (Q16206) Tumor-associated hydroquinone oxidase (tNOX) (Cytosolic| ovarian carcinoma antigen 1) (APK1 antigen) [Includes: Hydroquinone [NADH] oxidase (EC 1.-.-.-); Protein disulfide-thiol oxidoreductase (EC 1.-.-.-)] Length = 610 Score = 29.6 bits (65), Expect = 4.0 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +2 Query: 368 NGNLPPGFD---PSTCRSVYVGNVHPNVTENLLIE 463 N NLPP P C++V+VG + N TE +++E Sbjct: 112 NPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVE 146
>DOC2B_RAT (P70610) Double C2-like domain-containing protein beta (Doc2-beta)| Length = 412 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 200 RHSSPPTPTGSRHRGTEGPREPIDGSADWIQQINRFGGEF 81 R S+PP T GPR P DG+ D + +++ G + Sbjct: 51 RASAPPDAPARSPAATAGPRSPSDGARDDDEDVDQLFGAY 90
>VL96_IRV1 (P22856) L96 protein| Length = 867 Score = 29.3 bits (64), Expect = 5.2 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 32 KNLTSSSSVPLLDPPREIRRQIY*SVGSNPPIRRSVRAGPRSPGVSIRSESEEMNG 199 K +T P PP +RR P + +S A PRS S+R+E + G Sbjct: 420 KKITRKPKSPRRSPPASVRRS------RTPSVPKSPSARPRSKSPSVRAEITDDEG 469
>Y3471_BRAJA (Q89PK9) Hypothetical transport protein bll3471| Length = 562 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 97 LLICWIQSADPSIGSRGPSVPRCLDPVGVGG 189 LL W++S P++G+ P+ + L +G+GG Sbjct: 423 LLCGWLRSRRPTMGAMPPAAQQTLSDLGLGG 453
>PABPB_XENLA (Q6IP09) Polyadenylate-binding protein 1-B (Poly(A)-binding protein| 1-B) (Cytoplasmic poly(A)-binding protein 1-B) (PABP-B) (PABP 1-B) (xPABP1-B) Length = 633 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>PABP3_HUMAN (Q9H361) Polyadenylate-binding protein 3 (Poly(A)-binding protein| 3) (PABP 3) (Testis-specific poly(A)-binding protein) Length = 631 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>EPAB_XENTR (Q6DEY7) Embryonic polyadenylate-binding protein (Embryonic poly(A)| binding protein) (ePABP) Length = 629 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>PABP1_RAT (Q9EPH8) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>PABP1_MOUSE (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>PABP1_HUMAN (P11940) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>PABP1_BOVIN (P61286) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 410 SVYVGNVHPNVTENLLIE 463 S+YVG++HP+VTE +L E Sbjct: 12 SLYVGDLHPDVTEAMLYE 29
>GYS_DROME (Q9VFC8) Putative glycogen [starch] synthase (EC 2.4.1.11)| Length = 709 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 203 RRHSSPPTPTGSRHRGTEGPREPIDGSAD 117 R HS PP+PT SRH P + GS D Sbjct: 668 RPHSEPPSPTSSRH---TTPAPSVHGSDD 693 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,233,159 Number of Sequences: 219361 Number of extensions: 932924 Number of successful extensions: 3801 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3799 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
