| Clone Name | basd24f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 31 | 0.91 | 2 | IFRD1_MOUSE (P19182) Interferon-related developmental regulator ... | 30 | 2.0 |
|---|
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 0.91 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 98 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 214 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>IFRD1_MOUSE (P19182) Interferon-related developmental regulator 1 (Nerve growth| factor-inducible protein PC4) (TPA-induced sequence 7) (TIS7 protein) Length = 449 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/43 (27%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -3 Query: 153 VICM-ASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCFXSI 28 +IC A++++ R TC +C ++ T + ++++ L+CF +I Sbjct: 174 IICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECFENI 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,354,593 Number of Sequences: 219361 Number of extensions: 755744 Number of successful extensions: 1480 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1480 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)