| Clone Name | basd24a11 |
|---|---|
| Clone Library Name | barley_pub |
>MTR1A_PIG (O02781) Melatonin receptor type 1A (Mel-1A-R) (Mel1a melatonin| receptor) (Fragment) Length = 154 Score = 30.4 bits (67), Expect = 3.9 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -1 Query: 295 WHITRYDLCTAYMICASSSVTQI--LTVAVLHFDPVCCRCSRLWSSIHTFASSMSS 134 W+ R LC ++IC + V + L + L +DP C TFA S+SS Sbjct: 13 WYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSC--------TFAQSVSS 60
>MURG_CHLTE (Q8KGD4) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 364 Score = 30.4 bits (67), Expect = 3.9 Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 264 AVHKSYLVICHGVMHTVYICMSNHSVNLDKIRNLVIGTARRW--PYVNKLFHLVGCFGL 434 A++ + L +CH + TV + +++ D++R + +A RW PY+ ++ G L Sbjct: 204 AINNAVLKLCHRLEGTVNLIWQTGALDADRMRGEIGTSATRWIGPYIQEMGKAYGAADL 262
>IAAC2_WHEAT (P16851) Alpha-amylase/trypsin inhibitor CM2 precursor| (Chloroform/methanol-soluble protein CM2) Length = 145 Score = 30.0 bits (66), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 383 PGCPND*VADFIQIDRMIGHTNVYSVHYT 297 PGCP + DF ++ GH NV +VH T Sbjct: 109 PGCPREPQRDFAKVLVTPGHCNVMTVHNT 137
>GUAA_DESVH (Q72D86) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 515 Score = 29.6 bits (65), Expect = 6.6 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +3 Query: 117 CPAWP-MELIDEAKVWIELHKRLHLQHTGSKC--STATVRICVTDDEAHIIYAV 269 CP W ++L ++VW+ ++ G K TAT+ + DEA IYAV Sbjct: 116 CPLWDGLDLGTTSRVWMSHGDKVKTPPPGFKVVGRTATLEVAAMADEARRIYAV 169
>CLD9_MOUSE (Q9Z0S7) Claudin-9| Length = 217 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = +3 Query: 195 TGSKCSTATVRICVTDDEAHIIYAVHKSYLVICHGVMHTVYICMSNHSVNLDKIRNLVIG 374 TG++C+T CV D+ A + L++ G++ + +C + H++ D LV Sbjct: 100 TGAQCTT-----CVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAE 154 Query: 375 TARR 386 +R Sbjct: 155 ALKR 158
>RS27A_AERPE (P61297) 30S ribosomal protein S27ae| Length = 63 Score = 29.3 bits (64), Expect = 8.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 12 HAXYDSEXDFVVIRXAAASCPRCSSLYPYHGRP 110 H Y+ + + VI+ CPRC S+ +H +P Sbjct: 12 HKLYEVDYEKGVIKLKNRRCPRCGSIMAHHMKP 44
>GCH1_BIFLO (Q8G3S1) GTP cyclohydrolase I (EC 3.5.4.16) (GTP-CH-I)| Length = 199 Score = 29.3 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 258 IYAVHKSYLVICHGVMHTVYICMSNHSVNLDKIRNLVIGTARR 386 +Y+V + +L+ HGV H YI + + L K+ LV ARR Sbjct: 85 LYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARR 127
>IAAC1_WHEAT (P16850) Alpha-amylase/trypsin inhibitor CM1 precursor| (Chloroform/methanol-soluble protein CM1) Length = 145 Score = 29.3 bits (64), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 383 PGCPND*VADFIQIDRMIGHTNVYSVH 303 PGCP + DF ++ GH NV +VH Sbjct: 109 PGCPREPQRDFAKVLVTSGHCNVMTVH 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,165,437 Number of Sequences: 219361 Number of extensions: 2121381 Number of successful extensions: 4992 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4990 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)