| Clone Name | basd23j23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 12KD_FRAAN (Q05349) Auxin-repressed 12.5 kDa protein | 79 | 6e-15 | 2 | UL31_EBV (P03183) Protein BFLF2 | 31 | 2.5 | 3 | KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-as... | 30 | 4.3 |
|---|
>12KD_FRAAN (Q05349) Auxin-repressed 12.5 kDa protein| Length = 111 Score = 79.3 bits (194), Expect = 6e-15 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +1 Query: 28 RGGSVWRSVFHPGSNLATKGLGANLFDRPQPNSPTVYDWLYSDETRTR 171 R +VWRSVFHPGSNL++K +G +FD PQPNSPTVYDW+YS ETR++ Sbjct: 61 RKDNVWRSVFHPGSNLSSKTMGNQVFDSPQPNSPTVYDWMYSGETRSK 108
>UL31_EBV (P03183) Protein BFLF2| Length = 318 Score = 30.8 bits (68), Expect = 2.5 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -1 Query: 470 LRRPHHPHERIYTWSAHKVHTYTHHSLACGEQRAN*G*QKKVTSTS 333 LRR HPH R YT S H+ S CG+ R+ G ++V S + Sbjct: 21 LRRLMHPHHRNYTASKASAHSVKSVS-RCGKSRSELGRMERVGSVA 65
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.0 bits (66), Expect = 4.3 Identities = 23/70 (32%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +3 Query: 228 GTTPCLLLFWLSKSCVRTLLSEAACSFS*A**YYYTSACNFLLLPSVC--SLLAAC*RVM 401 GT PCL L SCV + +AAC S S C PS C + A+ Sbjct: 32 GTAPCLTLVCTPVSCVSSPCCQAACEPSPC-----QSGCTSSCTPSCCQPACCASSPCQQ 86 Query: 402 GVCVYFVCAP 431 CV C P Sbjct: 87 ACCVPVCCKP 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,644,863 Number of Sequences: 219361 Number of extensions: 1164074 Number of successful extensions: 3128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3126 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)