ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd23i11 |
|---|---|
| Clone Library Name | barley_pub |
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQ DYLIRS Sbjct: 45 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRS 82
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQ DYLIRS Sbjct: 46 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRS 83
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 77.4 bits (189), Expect = 1e-14 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWPIEGIKKFETLSYLPPLSTE LLKQ DYLIRS Sbjct: 46 RCMQVWPIEGIKKFETLSYLPPLSTEGLLKQVDYLIRS 83
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 76.6 bits (187), Expect = 2e-14 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWPIEGIKKFETLSYLPPLSTEAL KQ DYLIRS Sbjct: 45 RCMQVWPIEGIKKFETLSYLPPLSTEALSKQVDYLIRS 82
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWPIEGIKKFETLSYLPPL+ E LLKQ +YL+RS Sbjct: 46 RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRS 83
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYL 123 RCMQVWPIEGIKKFETLSYLPPL+ E LLKQ +YL Sbjct: 44 RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYL 78
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 66.2 bits (160), Expect = 2e-11 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP G KKFETLSYLPPLST+ LLKQ DYL+R+ Sbjct: 46 RCMQVWPAYGNKKFETLSYLPPLSTDDLLKQVDYLLRN 83
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 MQVWPIEGIKKFETLSYLPPL+ E LLKQ +YL+RS Sbjct: 48 MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRS 83
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G+KKFETLSYLPPLSTE+L K+ DYL+R Sbjct: 59 QCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLR 95
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP EG+KKFETLSYLPPLS E L K+ DYL+R+ Sbjct: 53 CMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRN 89
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP EG+KKFETLSYLPPLS E L K+ DYL+R+ Sbjct: 57 CMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRN 93
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP EG+KKFETLSYLPPLS E L K+ DYL+R+ Sbjct: 57 CMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRN 93
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP EG+KKFETLSYLPPLS E L K+ DYL+R+ Sbjct: 57 CMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRN 93
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP EG+KKFETLSYLPPLS E L K+ DYL+R+ Sbjct: 57 CMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRN 93
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP EG+KKFETLSYLPPLS E L K+ DYL+R+ Sbjct: 57 CMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRN 93
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 64.3 bits (155), Expect = 9e-11 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWPIEG+KKFETLSYLP + EAL+KQ +YL+RS Sbjct: 57 QCMKVWPIEGVKKFETLSYLPTMKDEALVKQIEYLLRS 94
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP G KKFETLSYLPPL+ E LLKQ DYL+R+ Sbjct: 45 RCMQVWPAYGNKKFETLSYLPPLTQEQLLKQVDYLLRN 82
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 63.5 bits (153), Expect = 2e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWPI G+KKFETLSYLP LS E+LLKQ +YLIR+ Sbjct: 58 QCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRN 95
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 63.5 bits (153), Expect = 2e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWPI G+KKFETLSYLP LS E+LLKQ +YLIR+ Sbjct: 58 QCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRN 95
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 63.5 bits (153), Expect = 2e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWPI G+KKFETLSYLP LS E+LLKQ +YLIR+ Sbjct: 58 QCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRN 95
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 63.5 bits (153), Expect = 2e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWPI G+KKFETLSYLP LS E+LLKQ +YLIR+ Sbjct: 58 QCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRN 95
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 62.8 bits (151), Expect = 3e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G+KKFETLSYLPPLS+E+L K+ DYL+R Sbjct: 59 QCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLR 95
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 62.0 bits (149), Expect = 4e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G+KKFETLSYLPPLS+E L K+ DYL+R Sbjct: 58 QCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLR 94
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 61.2 bits (147), Expect = 8e-10 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G+KK+ETLSYLPPLS EAL K+ DYLIR+ Sbjct: 56 QCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRN 93
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 61.2 bits (147), Expect = 8e-10 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP EG KKFETLSYLPPL+ E L ++ DYLIR+ Sbjct: 55 RCMQVWPPEGKKKFETLSYLPPLTREQLGQEVDYLIRN 92
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 60.5 bits (145), Expect = 1e-09 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +1 Query: 4 TVEGSR--CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 T GSR CMQVWP G KKFETLSYLPPL+ E LLK+ +YL+R Sbjct: 47 TSNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLLKEVEYLLR 90
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G+KKFETLSYLPPLS E+LLK+ YL+ + Sbjct: 57 QCMQVWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNN 94
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 58.2 bits (139), Expect = 6e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G KKFETLSYLPPLS E+LLK+ YL+ + Sbjct: 60 QCMQVWPPLGKKKFETLSYLPPLSEESLLKEVQYLLNN 97
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 58.2 bits (139), Expect = 6e-09 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 10 EGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 E +CMQVWP G KKFETLSYLPPL+ + LLK+ +YL+R Sbjct: 9 ERVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLR 48
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 57.8 bits (138), Expect = 8e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G KKFETLSYLPPL+ + LLK+ +YL+R Sbjct: 56 KCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLR 92
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 57.8 bits (138), Expect = 8e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G KKFETLSYLPPL+ + LLK+ +YL+R Sbjct: 56 KCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLR 92
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G KKFETLSYLPPLS E+L+K+ YL+ + Sbjct: 57 QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNN 94
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +CM+VWP G++KFETLSYLPPLS E+L KQ +YLI Sbjct: 58 QCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLI 93
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G KKFETLSYLPPLS E+L+K+ YL+ + Sbjct: 56 QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNN 93
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.4 bits (137), Expect = 1e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 CMQVWP G KKFETLSYLPPL+ E L K+ +YLIR Sbjct: 57 CMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIR 92
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G KKFETLSYLPPLS E+L+K+ YL+ + Sbjct: 54 QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNN 91
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G+KKFETLSYLPPL+ E L + +YL+RS Sbjct: 58 QCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRS 95
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 55.8 bits (133), Expect = 3e-08 Identities = 21/38 (55%), Positives = 32/38 (84%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP + +K++ETLSYLPPL+T+ L +Q DYL+ + Sbjct: 56 QCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNN 93
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 CMQVWP +KKFETLSYLP LS E+LLK+ +YL+ Sbjct: 56 CMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLL 90
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS E LLK+ +YL+++ Sbjct: 57 RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKN 94
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS E LLK+ +YL+++ Sbjct: 57 RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKN 94
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS E LLK+ +YL+++ Sbjct: 56 RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKN 93
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS E LLK+ +YL+++ Sbjct: 56 RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKN 93
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS E LLK+ +YL+++ Sbjct: 56 RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKN 93
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 55.1 bits (131), Expect = 5e-08 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CM+VWP G+KK+ETLSYLPPL+ L K+ DYL+R Sbjct: 54 QCMKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLLR 90
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 54.7 bits (130), Expect = 7e-08 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G++KFETLSYLP +S E L K+ DYL+R+ Sbjct: 58 QCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRN 95
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 54.3 bits (129), Expect = 9e-08 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP L+ E LLK+ +YL+++ Sbjct: 57 RCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKN 94
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 54.3 bits (129), Expect = 9e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 MQVWP G+KKFETLSYLPPL+TE LL + +YL+ Sbjct: 1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLL 34
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 54.3 bits (129), Expect = 9e-08 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS+E LL + +YL+++ Sbjct: 56 RCMQVWPPINMKKYETLSYLPDLSSEQLLSEIEYLLKN 93
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 54.3 bits (129), Expect = 9e-08 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G KKFETLSYLPPLS LL Q YL+ + Sbjct: 56 QCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNN 93
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 54.3 bits (129), Expect = 9e-08 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Frame = +1 Query: 4 TVEGSR--CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 T G R CMQVWP G KKFETLSYLP L+ L K+ DYLIR+ Sbjct: 47 TSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRN 91
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +CMQVWP G KKFETLSYLPPLS LL Q YL+ Sbjct: 58 QCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLL 93
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 53.9 bits (128), Expect = 1e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP G KFETLSYLP L+ E L+K+ +YL+R+ Sbjct: 50 RCMQVWPPFGNPKFETLSYLPTLTEEQLVKEVEYLLRN 87
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP G KKFETLSYLP L+ L K+ DYL+RS Sbjct: 58 QCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRS 95
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 53.9 bits (128), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = +1 Query: 13 GSR--CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 GSR CMQVW KFETLSYLPPLS +AL KQ DY+I+S Sbjct: 53 GSRVSCMQVWEPYNNLKFETLSYLPPLSQDALAKQIDYVIKS 94
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +CMQVWP G KKFETLSYLPPLS LL Q YL+ Sbjct: 59 QCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLL 94
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G K +ETLSYLPPL+ E L K+ +YL+R Sbjct: 58 QCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLR 94
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP +KK+ETLSYLP LS E LL + +YL+++ Sbjct: 57 RCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKN 94
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM VWP G+KKFETLSYLPPLS E+LLK+ YL+ + Sbjct: 57 QCM-VWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNN 93
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 RCMQVWP KKFETLSYLP L+ E L+K+ +YL+++ Sbjct: 66 RCMQVWPPYANKKFETLSYLPRLTPEQLVKEVEYLLKN 103
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +CMQVWP G KK+ETLSYLP L+ E LLK+ +YL+ Sbjct: 56 QCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLL 91
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +CMQVWP G KK+ETLSYLP L+ E LLK+ +YL+ Sbjct: 56 QCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLL 91
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 52.4 bits (124), Expect = 3e-07 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Frame = +1 Query: 4 TVEGSR--CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 T G R CM+VWP G KKFETLSYLP LS L K+ DYL+R+ Sbjct: 47 TSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRN 91
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G KKFETLSYLP L L K+ +YL+R Sbjct: 54 QCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLR 90
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G KKFETLSYLP L L K+ +YL+R Sbjct: 54 QCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLR 90
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 52.0 bits (123), Expect = 5e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CM+VWP G KKFETLSYLP LS L K+ DYL+R+ Sbjct: 55 CMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRN 91
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 52.0 bits (123), Expect = 5e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CM+VWP G KKFETLSYLP LS L K+ DYL+R+ Sbjct: 55 CMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRN 91
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 51.6 bits (122), Expect = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP KK+ETLSYLP LS E LL + +YL++S Sbjct: 56 QCMQVWPPINKKKYETLSYLPDLSQEQLLSEIEYLLKS 93
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP +KK+ETLSYLP LS E LL + +YL+++ Sbjct: 57 CMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKN 93
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP +KK+ETLSYLP LS E LL + +YL+++ Sbjct: 57 CMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKN 93
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CMQVWP +KK+ETLSYLP LS E LL + +YL+++ Sbjct: 57 CMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKN 93
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 51.2 bits (121), Expect = 8e-07 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP KK+ETLSYLP LS E LL++ +YL+++ Sbjct: 57 QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKN 94
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 51.2 bits (121), Expect = 8e-07 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Frame = +1 Query: 4 TVEGSR--CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 T G R CM+VWP G KKFETLSYLP L+ L K+ DYL+R+ Sbjct: 47 TSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRN 91
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 51.2 bits (121), Expect = 8e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G KKFETLSYLP L L K+ +YL+R Sbjct: 54 QCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLR 90
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G KK+ETLSYLP L+ L K+ DYL+R+ Sbjct: 49 QCMKVWPPVGKKKYETLSYLPELTEAQLAKEVDYLLRN 86
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 +CMQVWP G KKFETLSYLP L L K+ +YL+R Sbjct: 54 QCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLR 90
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP KK+ETLSYLP LS E LL + +YL+++ Sbjct: 56 QCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKN 93
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CMQVWP KK+ETLSYLP LS E LL + +YL+++ Sbjct: 56 QCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKN 93
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 50.1 bits (118), Expect = 2e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G KK+ETLSYLP L+ L K+ DYL+R+ Sbjct: 49 QCMKVWPPLGKKKYETLSYLPDLTEVQLAKEVDYLLRN 86
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CM+VWP G KKFETLSYLP L+ L K+ DYL+R+ Sbjct: 55 CMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLLRN 91
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 CM+VWP G KKFETLSYLP L+ L K+ DYL+R+ Sbjct: 55 CMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLLRN 91
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 50.1 bits (118), Expect = 2e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G KK+ETLSYLP L+ L K+ DYL+R+ Sbjct: 54 QCMKVWPPLGKKKYETLSYLPNLTEAQLAKEVDYLLRN 91
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 49.3 bits (116), Expect = 3e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G K++ETLSYLP L+ L K+ DYL+R+ Sbjct: 49 QCMKVWPPLGKKRYETLSYLPNLTESQLAKEVDYLLRN 86
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G K++ETLSYLP L+ L K+ DYL+R+ Sbjct: 54 QCMKVWPPLGKKRYETLSYLPNLTEAQLAKEVDYLLRN 91
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 48.5 bits (114), Expect = 5e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = +1 Query: 22 CMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIR 129 CM VWP KK+ETLSYLP LS E LLK+ +YL++ Sbjct: 57 CMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQ 92
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G K++ETLSYLP L+ L K+ DYL+R+ Sbjct: 49 QCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRN 86
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G K++ETLSYLP L+ L K+ DYL+R+ Sbjct: 49 QCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRN 86
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 47.8 bits (112), Expect = 9e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +CM+VWP G KK+ TLSYLP L+ L K+ DYL+R+ Sbjct: 49 QCMKVWPPLGKKKYXTLSYLPNLTEAQLAKEVDYLLRN 86
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = +1 Query: 4 TVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 T+ SR M VW K FET SYLPPL+ + + KQ DY++R+ Sbjct: 29 TISKSRAMMVWEPFNNKFFETFSYLPPLTDDQITKQVDYILRN 71
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A V+ R M VW K FET SYLPPL+ E + KQ DY++ Sbjct: 36 AAVQKCRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 77
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 43.5 bits (101), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 989 AAMTGEKDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 1030 Score = 43.5 bits (101), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 701 AAMTGEKDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 742 Score = 43.5 bits (101), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 558 AAMTGEKDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 599 Score = 43.5 bits (101), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 414 AAMTGEKDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 455 Score = 43.5 bits (101), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 271 AAMTGEKDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 312 Score = 43.1 bits (100), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 1133 AAMTGEKEMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 1174 Score = 43.1 bits (100), Expect = 2e-04 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 A + G + M+VW KKFET SYLPPLS + KQ D +I Sbjct: 846 AAMTGEKEMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 887 Score = 40.0 bits (92), Expect = 0.002 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 M+VW KKFET SYLPPLS + KQ D +I Sbjct: 135 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 168
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 42.4 bits (98), Expect = 4e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +1 Query: 16 SRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 SR M VW K FET SYLPPL+ E + KQ DY++ Sbjct: 42 SREMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 78
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 R M VW K FET SYLPPL+ E + KQ DY++ Sbjct: 42 RDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 77
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +1 Query: 1 ATVEGSRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 + V +R M VW K FET S+LPPL+ E + KQ DY++ Sbjct: 36 SAVNKNRDMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 77
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +1 Query: 70 SYLPPLSTEALLKQXDYLIRS 132 +YLPPLSTEALLKQ DYLIRS Sbjct: 1 AYLPPLSTEALLKQVDYLIRS 21
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +1 Query: 16 SRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +R M VW K FET SYLPPL+ E + KQ DY++ Sbjct: 40 NREMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 76
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = +1 Query: 19 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 R M VW K FET SYLPPL+ E + KQ DY++ Sbjct: 41 REMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 76
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 M VW K FET SYLPPLS E + Q DY++ Sbjct: 46 MMVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIV 79
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 16 SRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +R M VW K FET S+LPPL+ E + KQ DY++ Sbjct: 40 NRGMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 76
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 16 SRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +R M VW K FET S+LPPL+ E + KQ DY++ Sbjct: 40 NREMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 76
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 16 SRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +R M VW K FET S+LPPL+ E + KQ DY++ Sbjct: 40 NREMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 76
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 16 SRCMQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 +R M VW K FET S+LPPL+ E + KQ DY++ Sbjct: 31 NREMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 67
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 M VW K FET SYLPPL+ E + Q DY++ Sbjct: 46 MMVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIV 79
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 37.4 bits (85), Expect = 0.012 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +1 Query: 28 QVWPIEGIKKFETLSYLPPLSTEALLKQXDYLIRS 132 +VW K++ET SYLPPL+ + + +Q DY+I + Sbjct: 30 KVWQPVNNKQYETFSYLPPLTNQKIGRQVDYIINN 64
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 37.0 bits (84), Expect = 0.015 Identities = 13/26 (50%), Positives = 22/26 (84%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLIR 129 +++ETLSYLPPLS + + +Q +Y++R Sbjct: 8 RRYETLSYLPPLSDQQIARQIEYMVR 33
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 34.7 bits (78), Expect = 0.075 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 K++ETLSYLPPLS + + +Q Y++ Sbjct: 8 KRYETLSYLPPLSDQQIARQVQYMM 32
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 34.3 bits (77), Expect = 0.098 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 K+FET SYLP +S E + KQ +Y++ Sbjct: 24 KRFETFSYLPQMSAEEIRKQIEYIV 48
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 33.9 bits (76), Expect = 0.13 Identities = 12/25 (48%), Positives = 21/25 (84%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 +++ETLSYLPPL+ + + KQ ++L+ Sbjct: 8 RRYETLSYLPPLTDQQIAKQVEFLL 32
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 33.5 bits (75), Expect = 0.17 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 +KFET SYLP L E + KQ +Y++ Sbjct: 17 RKFETFSYLPELGVEKIRKQVEYIV 41
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 33.1 bits (74), Expect = 0.22 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 MQ P E +++ETLSYLPPL+ + KQ Y++ Sbjct: 1 MQTLPKE--RRYETLSYLPPLTDVQIEKQVQYIL 32
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 33.1 bits (74), Expect = 0.22 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 ++FET SYLPPLS + Q +Y+I Sbjct: 9 RRFETFSYLPPLSDRQIAAQIEYMI 33
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 32.3 bits (72), Expect = 0.37 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = +1 Query: 49 IKKFETLSYLPPLSTEALLKQXDYLI 126 I ++ET SYLPPL+ E +L+Q Y++ Sbjct: 13 IGRYETFSYLPPLNREEILEQILYIL 38
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 32.3 bits (72), Expect = 0.37 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 +KFET SYLPPL+ + + +Q Y + Sbjct: 7 RKFETFSYLPPLNDQQIARQLQYAL 31
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 31.2 bits (69), Expect = 0.83 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 +KFET SYLP + + + KQ +Y++ Sbjct: 16 RKFETFSYLPRMDADRIRKQVEYIV 40
>RBS_THIDA (Q56260) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 118 Score = 31.2 bits (69), Expect = 0.83 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 +KFET SYLP ++ + KQ +YL+ Sbjct: 17 RKFETFSYLPAMNAADIRKQVEYLV 41
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 55 KFETLSYLPPLSTEALLKQXDYLI 126 KFETLSYLP L+ + + +Q Y++ Sbjct: 18 KFETLSYLPALTADEIRQQVAYIV 41
>RBS_THINE (P45686) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 30.0 bits (66), Expect = 1.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 55 KFETLSYLPPLSTEALLKQXDYLI 126 K+ET SYLPP++ E + Q Y I Sbjct: 12 KYETFSYLPPMNAERIRAQIKYAI 35
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 29.3 bits (64), Expect = 3.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 25 MQVWPIEGIKKFETLSYLPPLSTEALLKQXDYLI 126 M V +KK+ET SYLP ++ E + +Q + I Sbjct: 1 MAVQAYRSLKKYETFSYLPQMTPEQVRRQIAHAI 34
>RBS1_HYDMR (Q59459) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 28.9 bits (63), Expect = 4.1 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 52 KKFETLSYLPPLSTEALLKQXDYLI 126 +K ET SYLP ++T+ + Q +Y+I Sbjct: 17 RKAETFSYLPKMTTDQIKAQVEYII 41
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 28.9 bits (63), Expect = 4.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 70 SYLPPLSTEALLKQXDYLI 126 SYLPPL+ E + KQ DY++ Sbjct: 2 SYLPPLTDEQISKQVDYIL 20
>RBS1_THIFE (P28896) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 110 Score = 28.9 bits (63), Expect = 4.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 55 KFETLSYLPPLSTEALLKQXDYLI 126 K+ET SYLP + E + +Q YLI Sbjct: 12 KYETFSYLPAMGPEKMRRQIAYLI 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,151,490 Number of Sequences: 219361 Number of extensions: 263469 Number of successful extensions: 985 Number of sequences better than 10.0: 121 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
