| Clone Name | basd23g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRAG_RHISN (P55421) Probable conjugal transfer protein traG | 34 | 0.42 | 2 | PEBB_SYNPX (Q7U4P6) Phycoerythrobilin:ferredoxin oxidoreductase ... | 31 | 3.5 |
|---|
>TRAG_RHISN (P55421) Probable conjugal transfer protein traG| Length = 640 Score = 33.9 bits (76), Expect = 0.42 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +1 Query: 106 FEEPALISGSSLPVPESYSLIVAIRCG*WC---SQPQRAHRPSKVGNARSQLLPANIHIQ 276 FE + IS +++ PE+ I + RCG Q R+ + RS+ L A IQ Sbjct: 532 FESASWISFAAINDPETADYI-SRRCGMTTVEIDQVSRSFQTKGSSRTRSKQLAARPLIQ 590 Query: 277 PHELCSEHLQQRIMRGNGDAPEICPKA 357 PHE+ ++I+ G+AP C +A Sbjct: 591 PHEVLRMRADEQIVFTAGNAPLRCGRA 617
>PEBB_SYNPX (Q7U4P6) Phycoerythrobilin:ferredoxin oxidoreductase (EC 1.3.7.3)| Length = 262 Score = 30.8 bits (68), Expect = 3.5 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = -2 Query: 241 WRFQPWRDGALAAAASTIIRNGWPQSSCRIQGQGERTPRLEPAPRS*VTSITWA 80 WR+QP+ D A +AA + +P + +Q +G + +P P VT+ TWA Sbjct: 18 WRWQPFLDEA-SAALKPFNPSPYPIAETFLQKEGSTGSKAKPVP---VTTATWA 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,458,824 Number of Sequences: 219361 Number of extensions: 1906423 Number of successful extensions: 5091 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5089 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)