| Clone Name | basd23f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4 | 53 | 5e-07 | 2 | TRP_DROME (P19334) Transient receptor potential protein | 33 | 0.75 | 3 | CARA_SULSO (Q59968) Carbamoyl-phosphate synthase small chain (EC... | 30 | 3.7 |
|---|
>RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4| Length = 211 Score = 53.1 bits (126), Expect = 5e-07 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +1 Query: 118 SEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKAG 234 S E +PKFG+WD N+P+SADG+T IFNK R+E+ +G Sbjct: 141 SPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSG 179
>TRP_DROME (P19334) Transient receptor potential protein| Length = 1275 Score = 32.7 bits (73), Expect = 0.75 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 160 DVNDPASADGFTVIFNKARDEKKAGNGQDTESPCKDAR 273 +V++ + ADG K D+KKAG+ +D + P KD++ Sbjct: 985 NVDEKSGADGKPGTMGKPTDDKKAGDDKDKQQPPKDSK 1022
>CARA_SULSO (Q59968) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 367 Score = 30.4 bits (67), Expect = 3.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 285 HPLSPGVFARGFSILSIPSLFLIPGFVEYNCESI 184 H + G++ RGFSI+ +P F +EYN + I Sbjct: 192 HGILYGLYKRGFSIVRVPCSFSASKIIEYNPKGI 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,876,146 Number of Sequences: 219361 Number of extensions: 1941703 Number of successful extensions: 5403 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5403 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)