ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd23e11 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 84.0 bits (206), Expect = 8e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 130 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA Sbjct: 76 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 82.8 bits (203), Expect = 2e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 130 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGC+ESGKA Sbjct: 137 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 82.4 bits (202), Expect = 2e-16 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 130 KEYPDAYVR+IGFDNMRQVQCVSFIAF+PPGCEESGKA Sbjct: 138 KEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 81.3 bits (199), Expect = 5e-16 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 130 KEYPDAYVR+IGFDN+RQVQCVSFIAF+PPGCEESGKA Sbjct: 137 KEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 73.2 bits (178), Expect = 1e-13 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 130 KEYPD Y RIIGFDNMRQVQ VSFIA KPPGCEESGKA Sbjct: 138 KEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 124 K YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 138 KAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 69.3 bits (168), Expect = 2e-12 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 124 K YPDA++RIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 138 KAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN RQVQCVSFIAFKPPG Sbjct: 149 KAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 60.5 bits (145), Expect = 1e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 124 K YPDA+VRIIGFDN+RQVQ +SFIA+ PGCEESG Sbjct: 136 KAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 KEYP A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 147 KEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 KEYP A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 147 KEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP+A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 149 KAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP+A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 149 KAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 KEYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 147 KEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP+A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 151 KEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 58.9 bits (141), Expect = 3e-09 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 KEYPDA++R+IGFDN+RQVQC+SFIA+KP Sbjct: 151 KEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 58.9 bits (141), Expect = 3e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 KEYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 48 KEYPNAFIRIIGFDNNRQVQCISFIAYKPP 77
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 58.5 bits (140), Expect = 4e-09 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP+A++R+IGFDN+RQVQC+SFI KPPG Sbjct: 149 KEYPNAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 58.5 bits (140), Expect = 4e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 KEYP A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 147 KEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 58.5 bits (140), Expect = 4e-09 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K +PD Y RIIGFDN+RQVQC+SF+A+KPPG Sbjct: 151 KHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 57.8 bits (138), Expect = 6e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 115 K YPD Y RIIGFDN+RQVQC+SF+A+KP G E Sbjct: 151 KAYPDCYGRIIGFDNVRQVQCISFLAYKPKGAE 183
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 57.8 bits (138), Expect = 6e-09 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 115 K YPDA+ R+IGFDN++Q QCVSFIA+KPPG + Sbjct: 138 KSYPDAFHRVIGFDNIKQTQCVSFIAYKPPGSD 170
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 KEYP+A +RIIGFDN RQVQC+SFIA+KPP Sbjct: 147 KEYPNALIRIIGFDNNRQVQCISFIAYKPP 176
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN RQVQC+SFIA+KP G Sbjct: 149 KEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQCVSFIA KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 20 EYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 EYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 148 EYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 20 EYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 EYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 148 EYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 57.0 bits (136), Expect = 1e-08 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 YP+ ++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 56.6 bits (135), Expect = 1e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YPDA++RIIGFDN+RQVQC+SFIA+KP Sbjct: 149 KAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP+A++RIIGFD+ RQVQCVSFIA+KP G Sbjct: 149 KEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 147 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 147 KEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 56.6 bits (135), Expect = 1e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 150 KSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 150 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/28 (78%), Positives = 28/28 (100%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 YP+A++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 149 YPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 150 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 150 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN RQVQCVSFIA+KP G Sbjct: 151 KAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 55.8 bits (133), Expect = 2e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 149 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 55.8 bits (133), Expect = 2e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 153 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 55.8 bits (133), Expect = 2e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 150 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 55.5 bits (132), Expect = 3e-08 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 149 KAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 55.5 bits (132), Expect = 3e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 152 KAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 55.5 bits (132), Expect = 3e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 152 KAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 55.5 bits (132), Expect = 3e-08 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 150 KAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 55.1 bits (131), Expect = 4e-08 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +2 Query: 5 RRXXKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 + K YP +++RIIGFDN RQVQC+SFIA+KPP Sbjct: 147 QEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 55.1 bits (131), Expect = 4e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YP A++RIIGFDN RQVQ +SFIA+KPPG Sbjct: 151 KAYPSAFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 54.7 bits (130), Expect = 5e-08 Identities = 21/28 (75%), Positives = 27/28 (96%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 YP+ ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 54.7 bits (130), Expect = 5e-08 Identities = 21/28 (75%), Positives = 27/28 (96%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 YP+ ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 54.7 bits (130), Expect = 5e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 152 YPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 KEYP A++RIIGFDN+RQVQC+SFIA KP Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKP 103 YPDA+VRIIGFDN RQVQC+SFIA+KP Sbjct: 150 YPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 54.3 bits (129), Expect = 7e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A+ RIIGFDN+RQVQC+SFIA+KP Sbjct: 147 KAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 54.3 bits (129), Expect = 7e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 53.9 bits (128), Expect = 9e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP A++RIIGFDN RQVQCVSFIA+KP Sbjct: 152 KAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 53.5 bits (127), Expect = 1e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 KEYP A++RIIGFDN+RQVQC+ FIA +P G Sbjct: 147 KEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 144 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 52.4 bits (124), Expect = 3e-07 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 20 EYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 EYPD+++RIIGFDN+RQVQC+SFIA P Sbjct: 150 EYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 KEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 KEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 KEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 52.0 bits (123), Expect = 3e-07 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 5 RRXXKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 R K YP A++R+IGFDN+RQVQC+SFI KP Sbjct: 138 RECAKAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 51.6 bits (122), Expect = 5e-07 Identities = 20/29 (68%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K YP+A++R+IGFDN+RQVQC+SFI KP Sbjct: 158 KAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 51.6 bits (122), Expect = 5e-07 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 20 EYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 EYP+A++RIIGFDN+RQVQC+SFIA P Sbjct: 148 EYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 51.2 bits (121), Expect = 6e-07 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K YPD + RIIGFDN RQVQC+SF+ +KP G Sbjct: 147 KAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 51.2 bits (121), Expect = 6e-07 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 KEYP A++R+IGFDN+RQVQCVSFI +P Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKP 103 YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKP 103 YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 48.1 bits (113), Expect = 5e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKP 103 YP+A+VR+IGF+N+RQVQC+SFIA P Sbjct: 107 YPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 109 K PDA+VR IGF++ R+VQC+SFIA+KP G Sbjct: 92 KAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 46.2 bits (108), Expect = 2e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = +2 Query: 5 RRXXKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 R EY D Y+R++GFDN++Q Q VSFI +KP Sbjct: 74 RECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 45.4 bits (106), Expect = 3e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = +2 Query: 5 RRXXKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 R EYP+ Y+R++GFDN++Q Q VSFI KP Sbjct: 74 RECRTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 42.7 bits (99), Expect = 2e-04 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +2 Query: 5 RRXXKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 R E P+ Y+R+IGFDN++Q Q VSFI KP Sbjct: 74 RECRSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +2 Query: 5 RRXXKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 R EY D Y+R+ GFDN++Q Q VSFI +P Sbjct: 75 RECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 41.2 bits (95), Expect = 6e-04 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = +2 Query: 20 EYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 +YP Y+R++GFDN++Q Q +SFI KP Sbjct: 79 QYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 40.8 bits (94), Expect = 8e-04 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAYVR++ FDN +QVQ + F+ +P + Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRPKSARD 176
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 40.8 bits (94), Expect = 8e-04 Identities = 13/29 (44%), Positives = 25/29 (86%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 +++P+AY+R++ FD++RQVQ + F+ +KP Sbjct: 77 QQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K +PDAYVR++ FDN +QVQ + F+ +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 40.0 bits (92), Expect = 0.001 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 +P+ Y+R++ FDN++QVQC+ F+ +P E Sbjct: 128 FPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 1094 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 806 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 663 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 519 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 376 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 232 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 36.6 bits (83), Expect = 0.015 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 + YP YVR+ FD+++QVQ +SF+ +P Sbjct: 1238 RAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266 Score = 35.4 bits (80), Expect = 0.033 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 121 + YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 951 RAYPQCYVRL-AFDSVKQVQVISFVVQRPSGSSSS 984
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 39.3 bits (90), Expect = 0.002 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 44 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 84 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 131 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 35 YVRIIGFDNMRQVQCVSFIAFKP 103 Y+R +GFDN RQVQC SFI +P Sbjct: 156 YIRCLGFDNTRQVQCASFIVHQP 178
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 K +PDAY+R++ FD RQVQ F+ +PP Sbjct: 142 KAFPDAYIRLVCFDANRQVQISGFLVHRPP 171
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 115 YP+ I+GFDN+RQ Q ++FIA+KP G E Sbjct: 139 YPELRA-ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 118 +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 35.8 bits (81), Expect = 0.026 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 K +PDAY+R++ FD RQVQ F+ +P Sbjct: 133 KAFPDAYIRLVCFDANRQVQISGFLVHRP 161
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 32.0 bits (71), Expect = 0.37 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 103 + YPD +VR++G+D Q + SF+A +P Sbjct: 84 RSYPDHHVRLVGYDTYAQSKGHSFLAHRP 112
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 106 K +P +VR+IG+DN Q Q + + F+ P Sbjct: 87 KAHPSHHVRLIGYDNYAQSQGTAMVIFRGP 116
>RBS_SYNPX (P0A4S5) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 100 + YPD +VRI+G+D Q Q F+ F+ Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_SYNPW (P0A4S6) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 100 + YPD +VRI+G+D Q Q F+ F+ Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>UL63_HCMVA (P16820) Hypothetical protein UL63| Length = 129 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Frame = +2 Query: 191 HCFGFSF-SIYLSYLFLRICVCPCSC-------TNMARENMLVCECCRWLCICTYA*YYT 346 H FG S+Y++Y++ +C C C + R N + + C LC T++ T Sbjct: 48 HLFGKKLISLYVTYIYYTLCTPNCRCCIRRKNSPYLYRLNFCLIDTCLELCPPTFSLCIT 107 Query: 347 IIC 355 IC Sbjct: 108 KIC 110
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 100 +E+PD VR + +DN Q Q ++F+ ++ Sbjct: 81 REFPDQMVRFVAYDNYAQSQGMAFVVYR 108
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 8 RXXKEYPDAYVRIIGFDNMRQVQCVSFIAFK 100 R K P +VRI+G+DN +Q Q S + ++ Sbjct: 84 RCHKRNPHNHVRIVGYDNFKQSQGTSLVVYR 114
>KE4_PONPY (Q5RFD5) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 324 HIHSHRQHSHTSMFSRAMLVHEHGHTH 244 H HSHR HSH H HGHTH Sbjct: 43 HGHSHR-HSHEDFHHGHSHAHGHGHTH 68 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 339 YYAYVHIHSHRQHSHTSMFSRAMLVHEHGHTH 244 ++ + H H H H+H S++ H+HGH+H Sbjct: 55 HHGHSHAHGHG-HTHESIWHGHTHGHDHGHSH 85
>KE4_HUMAN (Q92504) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 324 HIHSHRQHSHTSMFSRAMLVHEHGHTH 244 H HSHR HSH H HGHTH Sbjct: 43 HGHSHR-HSHEDFHHGHSHAHGHGHTH 68 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 339 YYAYVHIHSHRQHSHTSMFSRAMLVHEHGHTH 244 ++ + H H H H+H S++ H+HGH+H Sbjct: 55 HHGHSHAHGHG-HTHESIWHGHTHDHDHGHSH 85
>KE4_MOUSE (Q31125) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 476 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 339 YYAYVHIHSHRQ--HSHTSMFSRAMLVHEHGHTH 244 ++ + H HSH H H+ S H HGHTH Sbjct: 42 FHGHSHGHSHEDFHHGHSHGHSHEDFHHGHGHTH 75
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 29.6 bits (65), Expect = 1.8 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +2 Query: 26 PDAYVRIIGFDNMRQVQCVSFIAFKP 103 P+ +++IG+DN+RQ Q + + ++P Sbjct: 97 PNHLIKLIGYDNIRQTQGTAMLVYRP 122
>HNF1B_XENLA (Q91910) Hepatocyte nuclear factor 1-beta (HNF-1B) (LFB3) (XLFB3)| Length = 561 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 336 YAYVHIHSHRQHSHTSMFSRAMLVHEHGHTHILRN 232 + Y H H Q+SHTS F AM+V + L N Sbjct: 515 HMYAHKHEPPQYSHTSRFPSAMVVTDTSSISTLSN 549
>AMGO2_PONPY (Q5R7M3) Amphoterin-induced protein 2 precursor (AMIGO-2)| Length = 522 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 212 SIYLSYLFLRICVCPCSCTNMARENML 292 SI L L+L + CPC C ++NML Sbjct: 409 SIVLVLLYLYLTPCPCKCKTKRQKNML 435
>AMGO2_HUMAN (Q86SJ2) Amphoterin-induced protein 2 precursor (AMIGO-2)| (Alivin-1) (Differentially expressed in gastric adenocarcinomas) (DEGA) Length = 522 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 212 SIYLSYLFLRICVCPCSCTNMARENML 292 SI L L+L + CPC C ++NML Sbjct: 409 SIVLVLLYLYLTPCPCKCKTKRQKNML 435
>SRCH_HUMAN (P23327) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 699 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 324 HIHSHRQHSHTSMFSRAMLVHEHGHTHILRN 232 H+ SHR HSH ++ EH H HILR+ Sbjct: 151 HLPSHRSHSHQDEDEDEVVSSEH-HHHILRH 180
>RBS_GUITH (P14960) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 139 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQ--CVSFIAFKPPGCE 115 K P YV++ FDN R V+ C+SFI +P E Sbjct: 73 KAKPACYVKVNAFDNSRGVESCCLSFIVQRPTSNE 107
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 253 TYTYS*EQIRKINGEGKPKAMSELTKLQWHFICGPSSV 140 T+ Y I +NGEG K + L ++ +CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193
>ZIP1_ARATH (O81123) Zinc transporter 1 precursor (ZRT/IRT-like protein 1)| Length = 355 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 330 YVHIHSHRQHSHTSMFSRAMLVHEHGHTHILRNK 229 +VHIH+H H HT HG T ++R + Sbjct: 176 HVHIHTHASHGHT-----------HGSTELIRRR 198
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 10/53 (18%) Frame = +2 Query: 218 YLSYLFLRICVCPCSCTNM-----ARENMLVCEC-----CRWLCICTYA*YYT 346 YL + +CVC C C M E+ V C C +C+C Y Y+ Sbjct: 364 YLCSILSSVCVCVCVCVCMYVCMCVMESACVYVCVMESACVCVCMCVYVCVYS 416
>KE4_CANFA (Q5TJF6) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 324 HIHSHRQHSHTSMFSRAMLVHEHGHTH 244 H HSHR+ SH H HGHTH Sbjct: 43 HGHSHRR-SHEDFHHGHSYAHGHGHTH 68 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 336 YAYVHIHSHRQHSHTSMFSRAMLVHEHGHTH 244 ++Y H H H +H S++ HEHGH H Sbjct: 58 HSYAHGHGH---THESIWHGHTHGHEHGHAH 85
>RBS_PORAE (Q09125) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQ--CVSFIAFKP 103 K P+ Y+++ FDN R V+ C+SFI +P Sbjct: 73 KAKPNYYIKVNAFDNTRGVESCCLSFIINRP 103
>US27_HCMVA (P09703) G-protein coupled receptor homolog US27 (HHRF2)| Length = 362 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 347 LYNIMRTCIYIATDSIHIQACFLEPCWYMNMDIHIFLGTN-KKDKW 213 L N++ C+Y+ +++AC +N I+I +GT +KD W Sbjct: 268 LQNVIIFCLYVGQFLAYVRAC-------LNPGIYILVGTQMRKDMW 306
>RBS2_HYDMR (Q59461) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 122 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 23 YPDAYVRIIGFDNMRQVQCVSFIAFKPPG-CEESG 124 YP+ +R+IG+DN Q Q +F F G C G Sbjct: 84 YPNHMIRLIGYDNYTQCQGHNFCRFTVLGECNSHG 118
>BUD3_ASHGO (Q9HF61) Bud site selection protein BUD3| Length = 1478 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 324 HIHSHRQHSHTSMFSRAMLVHEHGHTHILRNK*ER*MEKENPKQ 193 H +++ S+ S H++G HILRN E E+P+Q Sbjct: 818 HKKDKKENKRNSVGSDTRNRHDNGSVHILRNSSSSFRELESPRQ 861
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 100 K +P+ +VR+IGFDN Q + + ++ Sbjct: 86 KAHPNNHVRLIGFDNYAQSKGAEMVVYR 113
>RNS10_RAT (Q5GAM0) Ribonuclease-like protein 10 precursor (Protein Train A)| Length = 212 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 264 VPTWLEKTCLYVNAVGGYVYARTHNIIQ*YVNYIRFN 374 VP W E T L + VGG R ++Q Y++F+ Sbjct: 75 VPVWSEDTVLSEDEVGGSRMLRAKTLLQSKQGYLKFD 111
>GALT_CLOPE (Q8XKP8) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12)| (Gal-1-P uridylyltransferase) (UDP-glucose--hexose-1-phosphate uridylyltransferase) Length = 498 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 344 YNIMRTCIYIATDSIHIQACFLEPCWYMNMDIHIFLGTNKKD 219 Y++ ++ YI TD I F P Y MDI I L +KD Sbjct: 115 YSLSKSSNYIRTDRIAKNINFKAPSKYGTMDITINLSKPEKD 156
>AMGO2_RAT (Q7TNJ4) Amphoterin-induced protein 2 precursor (AMIGO-2)| (Alivin-1) Length = 520 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 212 SIYLSYLFLRICVCPCSCTNMARENML 292 SI L L+L + CPC C + ++N L Sbjct: 409 SIVLVLLYLYLTPCPCKCRDKRQKNAL 435
>FKBP3_CANGA (Q6FKH7) FK506-binding protein 3 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) Length = 437 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 312 HRQHSHTSMFSRAMLVHEHGHTHILRNK*ER*MEKENPKQ 193 H++H H H+H H H +NK +R E+E PK+ Sbjct: 259 HKKHDHHHHHDHD---HDHDHEHKSKNK-KRKQEEEEPKK 294
>CLCN6_MOUSE (O35454) Chloride channel protein 6 (ClC-6)| Length = 870 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 293 VCECCRWLCIC 325 VC CCRW C C Sbjct: 8 VCCCCRWCCCC 18
>POXM_DROME (P23757) Paired box pox-meso protein (Paired box mesodermal| protein) Length = 402 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -1 Query: 324 HIHSHRQHSHTSMFSRAMLVHEHGHTH 244 H H H H + + A VH H H H Sbjct: 222 HPHHHHHHQSAAAAASAHHVHAHAHAH 248
>YHFA_SCHPO (O74751) Hypothetical protein C1734.10c in chromosome II| Length = 332 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 150 GPHIKCHCSFVNSDIAL 200 GP+ K HCSF N+++ L Sbjct: 164 GPNFKLHCSFCNAELGL 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,909,227 Number of Sequences: 219361 Number of extensions: 1079525 Number of successful extensions: 2644 Number of sequences better than 10.0: 145 Number of HSP's better than 10.0 without gapping: 2487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2627 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
