| Clone Name | basd23d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FSHR_EQUAS (Q95179) Follicle-stimulating hormone receptor precur... | 31 | 2.3 | 2 | HYI_ECOLI (P30147) Hydroxypyruvate isomerase (EC 5.3.1.22) | 30 | 4.0 | 3 | Y3536_METJA (Q60257) UPF0310 protein MJECL36 | 30 | 4.0 |
|---|
>FSHR_EQUAS (Q95179) Follicle-stimulating hormone receptor precursor (FSH-R)| (Follitropin receptor) Length = 687 Score = 30.8 bits (68), Expect = 2.3 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 383 SLQAMLEFGVVIHQQVCEQKERLRLCFQSQKPSLPQ*FP 267 SL A L G H QVC R+ LC +S+ +P P Sbjct: 7 SLLAFLSLGSGCHHQVCHYSNRVFLCQESKVTEIPSDLP 45
>HYI_ECOLI (P30147) Hydroxypyruvate isomerase (EC 5.3.1.22)| Length = 258 Score = 30.0 bits (66), Expect = 4.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 290 AFAIGNKALAALFVHTPAGELQRQIRAWLAENFDF 394 A A+GNK + L TPAG QI A L EN + Sbjct: 94 ARALGNKKINCLVGKTPAGFSSEQIHATLVENLRY 128
>Y3536_METJA (Q60257) UPF0310 protein MJECL36| Length = 144 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = +2 Query: 155 FKVNIKQ----EKKSKFSSIVLKLRGI-EEETWRQHVTGGKLREITEEAKAFAIGN 307 ++V +K+ E F ++ KL+ I ++ W H+ G +REI EE +GN Sbjct: 89 YRVKLKEIKVFEPPINFKELIPKLKFITNKKRWSGHLMGKAMREIPEEDYKLIVGN 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,346,567 Number of Sequences: 219361 Number of extensions: 1179478 Number of successful extensions: 3054 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3053 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)