| Clone Name | basd23c15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLAF6_MOUSE (Q9ET39) SLAM family member 6 precursor (Lymphocyte ... | 31 | 1.5 | 2 | CVRA_VIBPA (Q87KV8) Cell volume regulation protein A homolog | 29 | 7.6 | 3 | R13L4_ARATH (Q38834) Putative disease resistance RPP13-like prot... | 29 | 7.6 |
|---|
>SLAF6_MOUSE (Q9ET39) SLAM family member 6 precursor (Lymphocyte antigen 108)| Length = 351 Score = 31.2 bits (69), Expect = 1.5 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = -3 Query: 283 VISFSCGVLRYYEHSCGLVNNKRTHIL--GEDHIRMVCGIATQAKQLA-KWRENGNSQIC 113 VI+F +LR +E L T +L G I + C + Q++ ++ +W+ GN + Sbjct: 132 VITFKY-ILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLG 190 Query: 112 MSCVSPFPDPNTHSSSMRLCSMLNAMS 32 V+ F DP +C NA+S Sbjct: 191 GPNVTIFWDPRNSGDQTYVCRAKNAVS 217
>CVRA_VIBPA (Q87KV8) Cell volume regulation protein A homolog| Length = 581 Score = 28.9 bits (63), Expect = 7.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 Query: 183 WCVGSPLRPSSWPNGAR 133 WC+G PLR S P G R Sbjct: 427 WCIGEPLRSLSMPEGTR 443
>R13L4_ARATH (Q38834) Putative disease resistance RPP13-like protein 4| Length = 852 Score = 28.9 bits (63), Expect = 7.6 Identities = 14/65 (21%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Frame = -1 Query: 363 KITVLSLVQICTRASLKLRHLFWGRME*Y--LFRVVFYATTNIRVDW*TI-NGLTFLEKI 193 K+ +L + IC+ +K++ FWG + + ++ + +++ +DW + + +L + Sbjct: 762 KLPMLRYMSICSGNLVKMQEPFWGNENTHWRIEGLMLSSLSDLDMDWEVLQQSMPYLRTV 821 Query: 192 TFVWC 178 T WC Sbjct: 822 TANWC 826 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,139,182 Number of Sequences: 219361 Number of extensions: 1469081 Number of successful extensions: 4213 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4212 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)