| Clone Name | basd23b24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6... | 61 | 3e-13 | 2 | UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC... | 55 | 2e-11 | 3 | UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC... | 52 | 2e-10 | 4 | UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC... | 49 | 3e-09 | 5 | UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6... | 44 | 3e-04 |
|---|
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 60.8 bits (146), Expect(2) = 3e-13 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +2 Query: 257 MMSDYKVDMINDGMQEFFVHFHGPNDSTY 343 MMSDYKVDMINDGM EFFVHFHGP DS Y Sbjct: 16 MMSDYKVDMINDGMHEFFVHFHGPKDSIY 44 Score = 33.1 bits (74), Expect(2) = 3e-13 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 112 MSSPSKRREMDLMKLSAAPTK 174 MSSPSKRREMDLMKL + K Sbjct: 1 MSSPSKRREMDLMKLMMSDYK 21
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 54.7 bits (130), Expect(2) = 2e-11 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 257 MMSDYKVDMINDGMQEFFVHFHGPNDSTY 343 MMSDYKV+MINDGMQEFFV F GP DS Y Sbjct: 16 MMSDYKVEMINDGMQEFFVEFSGPKDSIY 44 Score = 33.1 bits (74), Expect(2) = 2e-11 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 112 MSSPSKRREMDLMKLSAAPTK 174 MSSPSKRREMDLMKL + K Sbjct: 1 MSSPSKRREMDLMKLMMSDYK 21
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 52.0 bits (123), Expect(2) = 2e-10 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 257 MMSDYKVDMINDGMQEFFVHFHGPNDSTY 343 MMSDYKV+ INDGMQEF+V F+GP DS Y Sbjct: 16 MMSDYKVETINDGMQEFYVEFNGPKDSLY 44 Score = 32.3 bits (72), Expect(2) = 2e-10 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +1 Query: 112 MSSPSKRREMDLMKLSAAPTK 174 MSSPSKRREMD+MKL + K Sbjct: 1 MSSPSKRREMDMMKLMMSDYK 21
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +2 Query: 257 MMSDYKVDMINDGMQEFFVHFHGPNDSTYPSASLSLSNPVP 379 MMSDYKVD +ND +Q F+V FHGP DS Y + +P Sbjct: 16 MMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELP 56 Score = 31.2 bits (69), Expect(2) = 3e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 112 MSSPSKRREMDLMKLSAAPTK 174 M+SPSKRREMD+MKL + K Sbjct: 1 MASPSKRREMDMMKLMMSDYK 21
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 43.9 bits (102), Expect = 3e-04 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +2 Query: 257 MMSDYKVDMINDGMQEFFVHFHGPNDSTYPSASLSLSNPVP 379 +MSD++VD+IND MQEF V F GP D+ Y + L +P Sbjct: 16 LMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELP 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,327,494 Number of Sequences: 219361 Number of extensions: 612761 Number of successful extensions: 1750 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1750 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)