ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd23b03 |
|---|---|
| Clone Library Name | barley_pub |
>Y4105_ARATH (Q9M158) Putative protein At4g01050| Length = 466 Score = 137 bits (344), Expect = 3e-32 Identities = 68/128 (53%), Positives = 85/128 (66%), Gaps = 7/128 (5%) Frame = +3 Query: 3 EGPRGWQSSDLPWIAPKKGFSLDFGEL-------FGDGSQGLPVXXXXXXXXXXXXXXYA 161 EGPRGW +S LPWI PKK SLD L FG+ S G+ V + Sbjct: 236 EGPRGWLNSSLPWIEPKKTLSLDLSSLTDSISGVFGESSDGVSVALGVAAAAGLSVFAFT 295 Query: 162 EIETVLQFLGSAAIVQVVASKLVYAEDRKKTLQQIDDFFNKKIAPKELVDEIKEIGQALL 341 EIET+LQ LGSAA+VQ+ KL++AEDRK+TL+Q+D+F N K+APKELVDE+KEIG+ALL Sbjct: 296 EIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKALL 355 Query: 342 PSSGEAKS 365 P S K+ Sbjct: 356 PQSTSNKA 363 Score = 36.6 bits (83), Expect = 0.053 Identities = 14/17 (82%), Positives = 17/17 (100%) Frame = +3 Query: 528 SRPLSPFANYPDLKPPA 578 SRPLSP+A+YPDLKPP+ Sbjct: 443 SRPLSPYASYPDLKPPS 459
>ZN496_HUMAN (Q96IT1) Zinc finger protein 496| Length = 587 Score = 32.3 bits (72), Expect = 1.0 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -3 Query: 361 LASPDEGRRACPISLISSTSSFGAIFLLKKSSIC--CRVFFRXXXXXXXXXXXXXXXAEP 188 L SP E +R+ P S SST + G + KKS +C C FR +P Sbjct: 375 LGSPTEKQRSLPASHRSSTEAGGEVQTSKKSYVCPNCGKIFRWRVNFIRHLRSRREQEKP 434 Query: 187 RNCS 176 CS Sbjct: 435 HECS 438
>TRI40_HUMAN (Q6P9F5) Tripartite motif 40 protein (RING finger protein 35)| Length = 258 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 128 CSYWFGNTCLRRDRNRAAVSGFSCHCPGCGKQARLCRGPKED 253 C + F CL + +A+ SG C CP LCR P E+ Sbjct: 29 CGHLFCRVCLTQHVEKASASGVFCCCP-------LCRKPSEE 63
>PCSK5_MOUSE (Q04592) Proprotein convertase subtilisin/kexin type 5 precursor (EC| 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (PC6) (Subtilisin-like proprotein convertase 6) (SPC6) Length = 1877 Score = 30.8 bits (68), Expect = 2.9 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 122 SCCSYWF--GNTCLRRDRNRAAVSGFSCHCPGCGKQARLCRGPK 247 SC WF G CL + R+ S C C K + CRGP+ Sbjct: 1563 SCRPGWFQLGKECLLQCRDGYYGESTSGRCEKCDKSCKSCRGPR 1606
>YKT7_CAEEL (P34318) Hypothetical protein C07A9.7| Length = 465 Score = 30.4 bits (67), Expect = 3.8 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 146 NTCLRRDRNRAAVSGFSCHCPGC--GKQARLCRGPKEDPAT 262 +T +R A+VSGF CHC C K ++ PK+ P T Sbjct: 271 HTFEQRTNFLASVSGFICHCESCFKMKSLKVLEKPKKYPET 311
>PHOB_SHIFL (P45607) Phosphate regulon transcriptional regulatory protein phoB| Length = 229 Score = 30.0 bits (66), Expect = 5.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 237 EDRKKTLQQ-IDDFFNKKIAPKELVDEIKEIGQALLPSSGE 356 EDR + L+ DD+ K +PKELV IK + + + P + E Sbjct: 89 EDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE 129
>PHOB_SHIDY (P45606) Phosphate regulon transcriptional regulatory protein phoB| Length = 229 Score = 30.0 bits (66), Expect = 5.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 237 EDRKKTLQQ-IDDFFNKKIAPKELVDEIKEIGQALLPSSGE 356 EDR + L+ DD+ K +PKELV IK + + + P + E Sbjct: 89 EDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE 129
>PHOB_KLEPN (P45605) Phosphate regulon transcriptional regulatory protein phoB| Length = 229 Score = 30.0 bits (66), Expect = 5.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 237 EDRKKTLQQ-IDDFFNKKIAPKELVDEIKEIGQALLPSSGE 356 EDR + L+ DD+ K +PKELV IK + + + P + E Sbjct: 89 EDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE 129
>PHOB_ECOLI (P0AFJ5) Phosphate regulon transcriptional regulatory protein phoB| Length = 229 Score = 30.0 bits (66), Expect = 5.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 237 EDRKKTLQQ-IDDFFNKKIAPKELVDEIKEIGQALLPSSGE 356 EDR + L+ DD+ K +PKELV IK + + + P + E Sbjct: 89 EDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE 129
>PHOB_ECO57 (P0AFJ6) Phosphate regulon transcriptional regulatory protein phoB| Length = 229 Score = 30.0 bits (66), Expect = 5.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 237 EDRKKTLQQ-IDDFFNKKIAPKELVDEIKEIGQALLPSSGE 356 EDR + L+ DD+ K +PKELV IK + + + P + E Sbjct: 89 EDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE 129
>NCKX6_RAT (Q6AXS0) Sodium/potassium/calcium exchanger 6 precursor| (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Solute carrier family 24 member 6) Length = 585 Score = 29.6 bits (65), Expect = 6.5 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = -2 Query: 323 FLNFINKLLWCNLLVKEVINLLQGL-------LSVLGIDELACHN 210 FL F+ LW N EV+N+L+ L +VLG+ LA N Sbjct: 423 FLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGN 467
>NCKX6_MOUSE (Q925Q3) Sodium/potassium/calcium exchanger 6 precursor| (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Solute carrier family 24 member 6) Length = 585 Score = 29.6 bits (65), Expect = 6.5 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = -2 Query: 323 FLNFINKLLWCNLLVKEVINLLQGL-------LSVLGIDELACHN 210 FL F+ LW N EV+N+L+ L +VLG+ LA N Sbjct: 423 FLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGN 467
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 98 SRFACHNWSCCSYWFGNTCLRRDRNRAAVSGFSCHCPGCGKQARLCR 238 S+ +C+ CCS G++C + + + S SC C C Q+ C+ Sbjct: 127 SQCSCYKPCCCSSGCGSSCCQSSCCKPSCSQSSC-CKPCCSQSSCCK 172
>ATS19_MOUSE (P59509) ADAMTS-19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 19) (ADAM-TS 19) (ADAM-TS19) Length = 1210 Score = 29.6 bits (65), Expect = 6.5 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 119 WSCCSYWFGNTCLRRDRNRAAVSGFSCHCPGCGKQARLCRGPKE 250 WS CS + R+R CPG G +AR C GP++ Sbjct: 645 WSSCSRSCSSGVSSRERK----------CPGLGSEARDCNGPRK 678
>NCKX6_HUMAN (Q6J4K2) Sodium/potassium/calcium exchanger 6 precursor| (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Solute carrier family 24 member 6) Length = 584 Score = 29.6 bits (65), Expect = 6.5 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = -2 Query: 323 FLNFINKLLWCNLLVKEVINLLQGL-------LSVLGIDELACHN 210 FL F+ LW N EV+N+L+ L +VLG+ LA N Sbjct: 423 FLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGN 467
>LSHB_PONPY (Q2Q1P0) Lutropin beta chain precursor (Luteinizing hormone beta| subunit) (LSH-beta) (LSH-B) (LH-B) Length = 141 Score = 29.6 bits (65), Expect = 6.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 194 SCHCPGCGKQARLCRGPKEDPAT 262 SCHC C + C GPK+ P T Sbjct: 107 SCHCGLCRRSTSDCGGPKDHPLT 129
>GRN_HUMAN (P28799) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granul Length = 593 Score = 29.3 bits (64), Expect = 8.5 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +2 Query: 119 WSCCSYWFGNTCLRRDRNRAAVSGFSCHCPG---CGKQARLCRGPKEDPA 259 W+CC Y G C DR +GF C G ++A P DPA Sbjct: 541 WACCPYRQGVCC--ADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPA 588
>BAI3_MOUSE (Q80ZF8) Brain-specific angiogenesis inhibitor 3 precursor| Length = 1522 Score = 29.3 bits (64), Expect = 8.5 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 119 WSCCSYWFGNTCLRRDRNRAAVSGFSCHCPGCGKQARLC 235 WS CS G + R R VS + HC G +++R+C Sbjct: 300 WSACSVTCGQGS--QVRTRTCVSPYGTHCSGPLRESRVC 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,484,640 Number of Sequences: 219361 Number of extensions: 1173072 Number of successful extensions: 4059 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 3896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4056 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
